GNL3L Antibody


Western Blot: GNL3L Antibody [NBP2-32660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-245
Immunocytochemistry/ Immunofluorescence: GNL3L Antibody [NBP2-32660] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry: GNL3L Antibody [NBP2-32660] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GNL3L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QPAKQNGKKATSKVPSAPHFVHPNDHANREAELKKKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELN
Specificity of human GNL3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GNL3L Protein (NBP2-32660PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GNL3L Antibody

  • EC 3.6.1
  • FLJ10613
  • guanine nucleotide binding protein-like 3 (nucleolar)-like
  • guanine nucleotide-binding protein-like 3-like protein
  • novel GTPase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, GS, ICC/IF
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for GNL3L Antibody (NBP2-32660) (0)

There are no publications for GNL3L Antibody (NBP2-32660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNL3L Antibody (NBP2-32660) (0)

There are no reviews for GNL3L Antibody (NBP2-32660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GNL3L Antibody (NBP2-32660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GNL3L Products

Bioinformatics Tool for GNL3L Antibody (NBP2-32660)

Discover related pathways, diseases and genes to GNL3L Antibody (NBP2-32660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNL3L Antibody (NBP2-32660)

Discover more about diseases related to GNL3L Antibody (NBP2-32660).

Pathways for GNL3L Antibody (NBP2-32660)

View related products by pathway.

PTMs for GNL3L Antibody (NBP2-32660)

Learn more about PTMs related to GNL3L Antibody (NBP2-32660).

Blogs on GNL3L

There are no specific blogs for GNL3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GNL3L Antibody and receive a gift card or discount.


Gene Symbol GNL3L