GNL3L Antibody - BSA Free

Western Blot: GNL3L Antibody [NBP1-84618] - Analysis using Anti-GNL3L antibody NBP1-84618 (A) shows similar pattern to independent antibody NBP2-32660 (B).

Staining of human cerebral cortex shows strong nuclear positivity in glial cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Staining of human endometrium shows moderate nuclear positivity in glandular cells.

Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GNL3L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GNL3L Antibody - BSA Free (NBP1-84618) is a polyclonal antibody validated for use in IHC and WB. Anti-GNL3L Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNL3L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GNL3L Protein (NBP1-84618PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24201379)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GNL3L Antibody - BSA Free

• EC 3.6.1
• FLJ10613
• guanine nucleotide binding protein-like 3 (nucleolar)-like
• guanine nucleotide-binding protein-like 3-like protein
• novel GTPase

Background

GNL3L is required for normal processing of ribosomal pre-rRNA. Required for cell proliferation. Binds GTP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GNL3L Antibody (NBP1-84618)(1)

Publication using NBP1-84618

• Fujita T, Asano Y, Ohtsuka J et al. Identification of telomere-associated molecules by engineered DNA-binding molecule-mediated chromatin immunoprecipitation (enChromatin Immunoprecipitation). Sci Rep 2013-11-08 [PMID: 24201379]

Bioinformatics

• Gene Symbol: GNL3L