GNL1 Antibody

Images

 
Western Blot: GNL1 Antibody [NBP2-14062] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GNL1 Antibody [NBP2-14062] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: GNL1 Antibody [NBP2-14062] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: Human cell line RT-4; Lane 3: Human cell line U-251MG; Lane 4: Human Plasma; Lane 5: Human liver tissue; ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LHFERDSREEVERRKRAAREQVLQPVSAELLELDIREVYQPGSVLDFPRR PPWSYEMSKEQLMSQEERSFQDYLGKIHGAY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GNL1 Protein (NBP2-14062PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNL1 Antibody

  • DKFZp547E038
  • DKFZp547E128
  • GTP-binding protein HSR1
  • guanine nucleotide binding protein-like 1
  • guanine nucleotide-binding protein-like 1
  • HSR1 GTP-binding protein
  • HSR1FLJ37752

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-81649
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP1-06526
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-45904
Species: Hu
Applications: WB, IHC, IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14062
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GNL1 Antibody (NBP2-14062) (0)

There are no publications for GNL1 Antibody (NBP2-14062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNL1 Antibody (NBP2-14062) (0)

There are no reviews for GNL1 Antibody (NBP2-14062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNL1 Antibody (NBP2-14062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNL1 Products

Bioinformatics Tool for GNL1 Antibody (NBP2-14062)

Discover related pathways, diseases and genes to GNL1 Antibody (NBP2-14062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNL1 Antibody (NBP2-14062)

Discover more about diseases related to GNL1 Antibody (NBP2-14062).
 

Pathways for GNL1 Antibody (NBP2-14062)

View related products by pathway.

PTMs for GNL1 Antibody (NBP2-14062)

Learn more about PTMs related to GNL1 Antibody (NBP2-14062).

Blogs on GNL1

There are no specific blogs for GNL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNL1