GNGT1 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit GNGT1 Antibody - Azide and BSA Free (NBP3-04725) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human GNGT1 (NP_068774.1). MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GNGT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
- Immunohistochemistry
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
8 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for GNGT1 Antibody - Azide and BSA Free
Background
GNGT1, also known as Guanine nucleotide-binding protein G(T) subunit gamma-T1, is a 74 amino acid that is 8 kDa, composed of 3 units, alpha, beta and gamma; found in the cell membrane; linked to 7-TM receptors; modulates or transduces in various transmembrane signaling systems; and its beta and gamma chains are requisite for the GTPase activity, for substitution of GDP by GTP, and for G protein-effector interaction. Studies on this protein has shown a relationship with fructose-1,6-bisphosphatase deficiency, retinitis pigmentosa, retinitis, and hypoxia. The GNGT1 protein has also shown an interaction with approx. 300 proteins including GNB1, GNB3, IKBKG, GNAS, and PLEKHB1 in several pathways including chemotaxis CXCR4 signaling pathway, translation regulation by Alpha-1 adrenergic receptors, development activation of ERK by Alpha-1 adrenergic receptors, cytoskeleton remodeling Role of PKA in cytoskeleton reorganization, development A1 receptor signaling, GPCR downstream signaling, transmission across chemical synapses, signaling by GPCR, G protein gated potassium channels, and neuronal system pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, PLA, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rt, Ze
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB, ICC/IF, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for GNGT1 Antibody (NBP3-04725) (0)
There are no publications for GNGT1 Antibody (NBP3-04725).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GNGT1 Antibody (NBP3-04725) (0)
There are no reviews for GNGT1 Antibody (NBP3-04725).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GNGT1 Antibody (NBP3-04725) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GNGT1 Products
Research Areas for GNGT1 Antibody (NBP3-04725)
Find related products by research area.
|
Blogs on GNGT1