GNG11 Antibody (2H5) - Azide and BSA Free

Proximity Ligation Assay: GNG11 Antibody (2H5) [H00002791-M01] - Analysis of protein-protein interactions between SMURF1 and GNG11. HeLa cells were stained with anti-SMURF1 rabbit purified polyclonal 1:1200 and anti-GNG11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Sandwich ELISA: GNG11 Antibody (2H5) [H00002791-M01] - Detection limit for recombinant GST tagged GNG11 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Func
• Clone: 2H5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GNG11 Antibody (2H5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GNG11 (NP_004117.1, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGS
• Specificity: GNG11 - guanine nucleotide binding protein (G protein), gamma 11 (2H5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GNG11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNG11 Antibody (2H5) - Azide and BSA Free

• GNGT11G protein gamma-11 subunit
• guanine nucleotide binding protein (G protein), gamma 11
• guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11

Background

This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG11
• Entrez:
  • 2791(Human)
• Uniprot:
  • NP_004117(Human)