GNG5 Antibody

Images

 
Western Blot: GNG5 Antibody [NBP2-14061] - Lane 1: Marker [kDa] 250, 150, 100, 75, 50, 37, 25, 20, 15, 10, 5, 2Lane 2: Human cell line SK-MEL-30
Immunohistochemistry-Paraffin: GNG5 Antibody [NBP2-14061] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNG5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNG5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GNG5 Protein (NBP2-14061PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNG5 Antibody

  • FLJ92393
  • GNGT5
  • guanine nucleotide binding protein (G protein), gamma 5
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80901
Species: Hu
Applications: IHC, IHC-P
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81811
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-16699
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-38953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5128
Species: Hu, Mu, Rt
Applications: WB
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30380
Species: Hu
Applications: IHC, IHC-P
NBP1-90278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP2-14061
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GNG5 Antibody (NBP2-14061) (0)

There are no publications for GNG5 Antibody (NBP2-14061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNG5 Antibody (NBP2-14061) (0)

There are no reviews for GNG5 Antibody (NBP2-14061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNG5 Antibody (NBP2-14061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNG5 Products

Bioinformatics Tool for GNG5 Antibody (NBP2-14061)

Discover related pathways, diseases and genes to GNG5 Antibody (NBP2-14061). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNG5 Antibody (NBP2-14061)

Discover more about diseases related to GNG5 Antibody (NBP2-14061).
 

Pathways for GNG5 Antibody (NBP2-14061)

View related products by pathway.

Research Areas for GNG5 Antibody (NBP2-14061)

Find related products by research area.

Blogs on GNG5

There are no specific blogs for GNG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNG5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNG5