GNG5 Antibody - BSA Free

Western Blot: GNG5 Antibody [NBP2-14061] - Lane 1: Marker [kDa] 250, 150, 100, 75, 50, 37, 25, 20, 15, 10, 5, 2Lane 2: Human cell line SK-MEL-30

Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.

Staining of human tonsil shows moderate cytoplasmic and membranous positivity in germinal center cells.

Staining of human testis shows weak cytoplasmic and membranous positivity in cells in seminiferous ducts.

Staining of human pancreas shows weak membranous positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GNG5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GNG5 Antibody - BSA Free (NBP2-14061) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNG5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GNG5 Protein (NBP2-14061PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GNG5 Antibody - BSA Free

• FLJ92393
• GNGT5
• guanine nucleotide binding protein (G protein), gamma 5
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

Background

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in varioustransmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement ofGDP by GTP, and for G protein-effector interaction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG5