GNG11 Antibody

Images

 
Western Blot: GNG11 Antibody [H00002791-B01P] - Analysis of GNG11 expression in transfected 293T cell line by GNG11 polyclonal antibody. Lane 1: GNG11 transfected lysate(8.14 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GNG11 Antibody Summary

Immunogen
GNG11 (AAH09709.1, 1 a.a. - 73 a.a.) full-length human protein. MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
Specificity
Reacts with guanine nucleotide binding protein (G protein), gamma 11.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GNG11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNG11 Antibody

  • GNGT11G protein gamma-11 subunit
  • guanine nucleotide binding protein (G protein), gamma 11
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11

Background

This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
MAB4446
Species: Hu, Mu, Rt
Applications: WB
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
NBP2-48952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2599
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14392
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002791-B01P
Species: Hu
Applications: WB

Publications for GNG11 Antibody (H00002791-B01P) (0)

There are no publications for GNG11 Antibody (H00002791-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNG11 Antibody (H00002791-B01P) (0)

There are no reviews for GNG11 Antibody (H00002791-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNG11 Antibody (H00002791-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNG11 Products

Bioinformatics Tool for GNG11 Antibody (H00002791-B01P)

Discover related pathways, diseases and genes to GNG11 Antibody (H00002791-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNG11 Antibody (H00002791-B01P)

Discover more about diseases related to GNG11 Antibody (H00002791-B01P).
 

Pathways for GNG11 Antibody (H00002791-B01P)

View related products by pathway.

Research Areas for GNG11 Antibody (H00002791-B01P)

Find related products by research area.

Blogs on GNG11

There are no specific blogs for GNG11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNG11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNG11
Entrez
Uniprot