GNB2 Antibody (6U9B3)

Western Blot: GNB2 Antibody (6U9B3) [NBP3-16846] - Western blot analysis of extracts of various cell lines, using GNB2 Rabbit mAb (NBP3-16846) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: GNB2 Antibody (6U9B3) [NBP3-16846] - Immunohistochemistry of paraffin-embedded human lung cancer using GNB2 Rabbit mAb (NBP3-16846) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 6U9B3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

GNB2 Antibody (6U9B3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human GNB2 (P62879). MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GNB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GNB2 Antibody (6U9B3)

• beta-2 subunit
• guanine nucleotide binding protein (G protein), beta polypeptide 2
• guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2
• guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
• signal-transducing guanine nucleotide-binding regulatory protein beta subunit

Background

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNB2