GNAL Antibody

Immunohistochemistry: GNAL Antibody [NBP2-68695] - Immunohistochemical staining of human caudate shows strong positivity in neuropil.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GNAL Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNAL
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  GNAL Recombinant Protein Antigen (NBP2-68695PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for GNAL Antibody

• Adenylate cyclase-stimulating G alpha protein, olfactory type
• guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory typ
• guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory type
• guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide, olfactory type
• guanine nucleotide-binding protein G(olf) subunit alpha

Background

Heterotrimeric G proteins function to relay information from cell surface receptors to intracellular effectors. Each of a very broad range of receptors specifically detects an extracellular stimulus (a photon, pheromone, odorant, hormone or neurotransmitter) while the effectors (e.g. adenyl cyclase), which act to generate one or more intracellular messengers, are less numerous. In mammals, G protein alpha, beta and gamma polypeptides are encoded by at least 16, 4 and 7 genes, respectively. Most interest in G proteins has been focused on their alpha subunits, since these proteins bind and hydrolyze GTP, and most obviously regulate the activity of the best studied effectors. The Gs subfamily of Galpha subunits includes two closely related proteins, Galpha s and Galpha olf, which, respectively, stimulate adenylate cyclase and mediate response to olfactory stimuli.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNAL