IMPA2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IMPA2 Antibody [NBP1-86352] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & mitochondria.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.

Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.

Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Analysis in control (vector only transfected HEK293T lysate) and IMPA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IMPA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IMPA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IMPA2 Protein (NBP1-86352PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IMPA2 Antibody - BSA Free

• EC 3.1.3.25
• IMP 2
• IMP.18P
• IMPase 2
• inosine monophosphatase 2
• inositol monophosphatase 2 variant 1
• inositol monophosphatase 2 variant 2
• inositol monophosphatase 2
• inositol(myo)-1(or 4)-monophosphatase 2
• Inositol-1(or 4)-monophosphatase 2
• Myo-inositol monophosphatase A2

Background

IMPA2, also known as Inositol monophosphatase 2, has a 288 amino acid isoform that is 31 kDa and a short 261 amino acid that is 29 kDa, catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling, can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates, and serves as possible pharmacological target for lithium Li+ action in brain. Studies are being performed on the relationship of this protein to bipolar disorder, mood disorder, seizures, schizophrenia, febrile seizures, bipolar affective disorder, neisseria meningitides, pneumonia, tuberculosis, neuronitis, schizophrenia and leukemia. The protein has been shown to interact with HERPUD1, TNFRSF1H, INPP1, ISYNA1, and PLCG1 in inositol phosphate metabolism, metabolic pathways and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IMPA2