Recombinant Human GMF-beta Protein

Images

 
There are currently no images for GMF-beta Protein (NBP1-99442).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications PAGE
Concentration
Lyoph

Order Details

Recombinant Human GMF-beta Protein Summary

Description
Recombinant protein for Human GMF-beta

Source:E. coli
Amino Acid Sequence:(P60983) - SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH.

Preparation
Method
Determined to be >98% pure by SDS-PAGE
Source
E. coli
Protein/Peptide Type
Recombinant Protein
Gene
GMFB
Purity
>95%, by SDS-PAGE

Applications/Dilutions

Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20 to -80C. Avoid freeze-thaw cycles.
Buffer
Lyophilized after dialysis against 20 mM PBS pH 7.4 and 130 mM NaCl.
Concentration
Lyoph
Purity
>95%, by SDS-PAGE
Reconstitution Instructions
Centrifuge the vial prior to opening. Reconstitute in sterile H2O to a concentration> 100 ug/ml. This solution can then be diluted into other aqueous buffers.

Alternate Names for Recombinant Human GMF-beta Protein

  • glia maturation factor beta
  • glia maturation factor, beta
  • GMF
  • GMFB
  • GMFbeta
  • GMF-beta

Background

Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve growth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression.GMF-beta enhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Cell- surface GMF-Beta acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells.GMF-Beta is a brain-specific protein which belongs to the actin-binding proteins (ADF) family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31367
Species: Hu
Applications: WB, ICC/IF
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-99442
Species: Hu
Applications: PAGE

Publications for GMF-beta Protein (NBP1-99442) (0)

There are no publications for GMF-beta Protein (NBP1-99442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMF-beta Protein (NBP1-99442) (0)

There are no reviews for GMF-beta Protein (NBP1-99442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GMF-beta Protein (NBP1-99442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GMF-beta Products

Bioinformatics Tool for GMF-beta Protein (NBP1-99442)

Discover related pathways, diseases and genes to GMF-beta Protein (NBP1-99442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMF-beta Protein (NBP1-99442)

Discover more about diseases related to GMF-beta Protein (NBP1-99442).
 

Pathways for GMF-beta Protein (NBP1-99442)

View related products by pathway.

PTMs for GMF-beta Protein (NBP1-99442)

Learn more about PTMs related to GMF-beta Protein (NBP1-99442).

Blogs on GMF-beta

There are no specific blogs for GMF-beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GM-CSF [Unconjugated]
215-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GMF-beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GMFB
Entrez