Recombinant Human GMF-beta Protein

Product Discontinued

Recombinant Human GMF-beta Protein Summary

• Description: Recombinant protein for Human GMF-beta
  
  

  Source:E. coli
  Amino Acid Sequence:(P60983) - SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH.

• Preparation Method: Determined to be >98% pure by SDS-PAGE
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: GMFB
• Purity: >98%, by SDS-PAGE

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20 to -80C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized after dialysis against 20 mM PBS (pH 7.4), 130 mM NaCl.
• Concentration: Lyoph
• Purity: >98%, by SDS-PAGE
• Reconstitution Instructions: Centrifuge vial prior to opening. Reconstitute in sterile H2O to >100 ug/ml. This solution can then be diluted into other aqueous buffers.

Alternate Names for Recombinant Human GMF-beta Protein

• glia maturation factor beta
• glia maturation factor, beta
• GMF
• GMFB
• GMFbeta
• GMF-beta

Background

Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve growth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression.GMF-beta enhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Cell- surface GMF-Beta acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells.GMF-Beta is a brain-specific protein which belongs to the actin-binding proteins (ADF) family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GMFB