Glycophorin C Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Analysis in human bone marrow and pancreas tissues using NBP1-84597 antibody. Corresponding GYPC RNA-seq data are ...read more
Western Blot: Glycophorin C Antibody [NBP1-84597] - Analysis in control (vector only transfected HEK293T lysate) and GYPC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human bone marrow shows strong membranous positivity in erythrocytes.
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human placenta shows strong membranous positivity in erythrocytes.
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Glycophorin C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GYPC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glycophorin C Protein (NBP1-84597PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glycophorin C Antibody

  • CD236 antigen
  • CD236
  • CD236R
  • GE
  • GLPC
  • glycoconnectin
  • glycophorin C (Gerbich blood group)
  • glycophorin-C
  • glycophorin-D
  • Glycoprotein beta
  • GPCMGC126191
  • GPD
  • GYPD
  • MGC117309
  • MGC126192
  • PAS-2
  • PAS-2'
  • Sialoglycoprotein D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP1-85010
Species: Hu
Applications: IHC, IHC-P, WB
MAB7265
Species: Mu
Applications: IHC, WB
NBP1-84597
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB500-526
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00025861-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP2-94256
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-20619
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for Glycophorin C Antibody (NBP1-84597) (0)

There are no publications for Glycophorin C Antibody (NBP1-84597).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycophorin C Antibody (NBP1-84597) (0)

There are no reviews for Glycophorin C Antibody (NBP1-84597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycophorin C Antibody (NBP1-84597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycophorin C Products

Bioinformatics Tool for Glycophorin C Antibody (NBP1-84597)

Discover related pathways, diseases and genes to Glycophorin C Antibody (NBP1-84597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycophorin C Antibody (NBP1-84597)

Discover more about diseases related to Glycophorin C Antibody (NBP1-84597).
 

Pathways for Glycophorin C Antibody (NBP1-84597)

View related products by pathway.

PTMs for Glycophorin C Antibody (NBP1-84597)

Learn more about PTMs related to Glycophorin C Antibody (NBP1-84597).
 

Research Areas for Glycophorin C Antibody (NBP1-84597)

Find related products by research area.

Blogs on Glycophorin C

There are no specific blogs for Glycophorin C, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycophorin C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GYPC