Glycophorin C Antibody

Images

 
Western Blot: Glycophorin C Antibody [NBP1-84597] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597] - Staining of human colon shows strong immunoreactivity in erythrocytes present in blood vessel and moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glycophorin C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GYPC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glycophorin C Protein (NBP1-84597PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glycophorin C Antibody

  • CD236 antigen
  • CD236
  • CD236R
  • GE
  • GLPC
  • glycoconnectin
  • glycophorin C (Gerbich blood group)
  • glycophorin-C
  • glycophorin-D
  • Glycoprotein beta
  • GPCMGC126191
  • GPD
  • GYPD
  • MGC117309
  • MGC126192
  • PAS-2
  • PAS-2'
  • Sialoglycoprotein D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
MAB6967
Species: Hu
Applications: WB
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84597
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Glycophorin C Antibody (NBP1-84597) (0)

There are no publications for Glycophorin C Antibody (NBP1-84597).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycophorin C Antibody (NBP1-84597) (0)

There are no reviews for Glycophorin C Antibody (NBP1-84597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycophorin C Antibody (NBP1-84597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycophorin C Products

Bioinformatics Tool for Glycophorin C Antibody (NBP1-84597)

Discover related pathways, diseases and genes to Glycophorin C Antibody (NBP1-84597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycophorin C Antibody (NBP1-84597)

Discover more about diseases related to Glycophorin C Antibody (NBP1-84597).
 

Pathways for Glycophorin C Antibody (NBP1-84597)

View related products by pathway.

PTMs for Glycophorin C Antibody (NBP1-84597)

Learn more about PTMs related to Glycophorin C Antibody (NBP1-84597).
 

Research Areas for Glycophorin C Antibody (NBP1-84597)

Find related products by research area.

Blogs on Glycophorin C

There are no specific blogs for Glycophorin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycophorin C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GYPC