Glycogenin 1 Antibody - BSA Free

Western Blot: Glycogenin 1 Antibody [NBP3-17719] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Immunohistochemistry-Paraffin: Glycogenin 1 Antibody [NBP3-17719] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glycogenin 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glycogenin 1 Antibody - BSA Free (NBP3-17719) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRP
• Predicted Species: Mouse (97%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GYG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glycogenin 1 Antibody - BSA Free

• EC 2.4.1.186
• glycogenin 1
• glycogenin
• glycogenin-1
• GN1
• GN-1
• GSD15
• GYG

Background

Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substratefor glycogen synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GYG1