Glycine Receptor Alpha 1 Antibody - BSA Free

Staining of human liver shows strong cytoplasmic positivity in bile duct cells.

Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Staining of mouse spinal cord shows strong cytoplasmic positivity in neuronal cell bodies and processes in the gray matter.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human pancreas shows strong cytoplasmic positivity in intercalated ducts.

Staining of human eye, retina shows moderate cytoplasmic positivity in outer nuclear layer and inner plexiform layer..

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glycine Receptor Alpha 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLRA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glycine Receptor Alpha 1 Protein (NBP1-86988PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glycine Receptor Alpha 1 Antibody - BSA Free

• GLRA 1
• GLRA1
• Glycine receptor 48 kDa subunit
• Glycine receptor strychnine-binding subunit
• glycine receptor subunit alpha-1
• glycine receptor, alpha 1 (startle disease/hyperekplexia)
• glycine receptor, alpha 1
• HKPX1
• MGC138878
• MGC138879
• STHE

Background

Glycine is an important inhibitory neurotransmitter in the mammalian central nervous system, especially in the brainstem and spinal cord. It acts by binding to anion-conducting glycine receptors that belong to a superfamily of ligand-gated ion channels. Glycine receptors were first purified as strychnine binding sites in membrane fractions of adult spinal cord from rats (1). These strychnine-sensitive binding sites are different from the strychnine-insensitive binding sites found in the N-methyl-D-aspartate (NMDA) subtype of glutamate receptors. Adult glycine receptors are heterodimers composed of two subunits of 48 kDa and 58 kDa, denoted as a1 and b subunits. Fetal glycine receptors are homomers composed of a2 subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLRA1