Glutathione Synthetase Recombinant Protein Antigen

Images

 
There are currently no images for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glutathione Synthetase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutathione Synthetase.

Source: E. coli

Amino Acid Sequence: ISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPGMLEMLLPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GSS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50420.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Glutathione Synthetase Recombinant Protein Antigen

  • EC 6.3.2.3
  • Glutathione synthase
  • glutathione synthetase
  • GSH synthetase
  • GSHS
  • GSH-S
  • MGC14098

Background

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage byfree radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as ahomodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion ofgamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-88263
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92873
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-56928
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-86661
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P

Publications for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP) (0)

There are no publications for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP) (0)

There are no reviews for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutathione Synthetase Products

Bioinformatics Tool for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP)

Discover related pathways, diseases and genes to Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP)

Discover more about diseases related to Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP).
 

Pathways for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP)

View related products by pathway.

PTMs for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP)

Learn more about PTMs related to Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP).
 

Research Areas for Glutathione Synthetase Recombinant Protein Antigen (NBP2-57177PEP)

Find related products by research area.

Blogs on Glutathione Synthetase

There are no specific blogs for Glutathione Synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nrf2 Antibody
NBP1-32822

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glutathione Synthetase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GSS