Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84748] - Staining of human urinary bladder.

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84748] - Staining of human kidney, liver, testis and urinary bladder using Anti-GSTP1 antibody NBP1-84748 (A) shows similar protein distribution across tissues to independent antibody NBP1-84747 (B).

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84748] - Staining of human testis.

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84748] - Staining of human liver.

Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP1-84748] - Staining of human kidney.

Analysis in human cell line A-549.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glutathione S-Transferase pi 1/GSTP1 Protein (NBP1-84748PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

• deafness, X-linked 7
• DFN7
• EC 2.5.1.18
• FAEES3
• fatty acid ethyl ester synthase III
• glutathione S-transferase P
• Glutathione STransferase pi 1
• Glutathione S-Transferase pi 1
• GST class-pi
• GST3DFN7
• GSTP
• GSTP1
• GSTP1-1
• PI

Background

GSTP1 (glutathione-S-transferase, pi 1), also called GST3/DFN7, which is located on chromosome 11q13 , is a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 act like a tumor suppressor gene, which when inactivated leads to tumor growth, and the -class glutathione S-transferase is commonly inactivated by somatic CpGisland hypermethylation in cancers of the prostate, liver, and breast. Methylation of regulatory sequences at the GSTP1 gene locus is found in the vast majority (>90%) of prostate carcinomas and is associated with transcriptional down-regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glutathione S-Transferase pi 1/GSTP1 Antibody (NBP1-84748)(1)

Publication using NBP1-84748

• Pellacani D, Kestoras D, Droop AP et al. DNA hypermethylation in prostate cancer is a consequence of aberrant epithelial differentiation and hyperproliferation. Cell Death Differ 2014-05-01 [PMID: 24464224] (ICC/IF, WB)

Bioinformatics

• Gene Symbol: GSTP1