Glutathione S-transferase Mu 5 Antibody - BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human Glutathione S-transferase Mu 5 (NP_000842.2).
Sequence: LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GSTM5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Glutathione S-transferase Mu 5 Antibody - BSA Free
Background
The GSTM5 (glutathione S-transferase Mu 5) gene codes for a 218 amino acid long, 25 kDA protein that functions as a catalyst in various reactions in eukaryotes and prokaryotes such as converting reduced gluthathione to a large number of exogenous and endogenous hydrophobic electrophiles. GSTM5 has been linked to various diseases such as hypertension, hepatitis, adenocarcinoma, breast cancer, coronary heart disease, and hypertension. GSTM5 participates in gluthione metabolism and conjugation as well as metapathway biotransformation and has been known to interact with various genes such as CYP1A1, CYP1B1, CYP2B6, CYP2C19, and ALDH1A3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Publications for Glutathione S-transferase Mu 5 Antibody (NBP3-35584) (0)
There are no publications for Glutathione S-transferase Mu 5 Antibody (NBP3-35584).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glutathione S-transferase Mu 5 Antibody (NBP3-35584) (0)
There are no reviews for Glutathione S-transferase Mu 5 Antibody (NBP3-35584).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glutathione S-transferase Mu 5 Antibody (NBP3-35584) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glutathione S-transferase Mu 5 Products
Research Areas for Glutathione S-transferase Mu 5 Antibody (NBP3-35584)
Find related products by research area.
|
Blogs on Glutathione S-transferase Mu 5