Glutathione S Transferase kappa 1 Recombinant Protein Antigen

Images

 
There are currently no images for Glutathione S Transferase kappa 1 Protein (NBP1-89726PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glutathione S Transferase kappa 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GSTK1.

Source: E. coli

Amino Acid Sequence: PYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GSTK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89726.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glutathione S Transferase kappa 1 Recombinant Protein Antigen

  • EC 2.5.1.18
  • glutathione S-transferase k1
  • glutathione S-transferase kappa 1
  • glutathione S-transferase subunit 13 homolog
  • Glutathione S-transferase subunit 13
  • GST 13-13
  • GST class-kappa
  • GST
  • GST13
  • GST13-13
  • GSTK1-1
  • hGSTK1

Background

Glutathione transferases (GSTs) are a superfamily of enzymes that play a vital functional role in the cellular detoxification process. They catalyze the conjugation of the thiol group of glutathione (GSH) to the electrophilic groups of a wide range of hydrophobic substrates, leading to an easier removal of the latter from the cells (1) The Kappa class of GSTs comprises soluble enzymes originally isolated from the mitochondrial matrix of rats. Gsk1 catalyses some typical GST reactions, it has been proposed that it is structurally distinct from other classes of cytosolic GSTs (2). Gsk1 has been identified in rat, mouse, and human. The C terminus of Gsk1 was essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
H00002946-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-61574
Species: Bv, Gt, Hu, Mu, Sh
Applications: WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB200-209
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00002938-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89726PEP
Species: Hu
Applications: AC

Publications for Glutathione S Transferase kappa 1 Protein (NBP1-89726PEP) (0)

There are no publications for Glutathione S Transferase kappa 1 Protein (NBP1-89726PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione S Transferase kappa 1 Protein (NBP1-89726PEP) (0)

There are no reviews for Glutathione S Transferase kappa 1 Protein (NBP1-89726PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glutathione S Transferase kappa 1 Protein (NBP1-89726PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutathione S Transferase kappa 1 Products

Blogs on Glutathione S Transferase kappa 1

There are no specific blogs for Glutathione S Transferase kappa 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glutathione S Transferase kappa 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTK1