Glutathione Peroxidase 7 Antibody [mFluor Violet 610 SE]

Product Discontinued

Glutathione Peroxidase 7 Antibody [mFluor Violet 610 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-187 of human Glutathione Peroxidase 7 (NP_056511.2).
  
  Sequence:
  QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPX7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Glutathione Peroxidase 7 Antibody [mFluor Violet 610 SE]

• CL683
• EC 1.11.1
• FLJ14777
• glutathione peroxidase 6
• glutathione peroxidase 7
• GPX6EC 1.11.1.9
• GPx-7
• GSHPx-7
• non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase
• NPGPx

Background

Glutathione peroxidase 7 (GPX7) belongs to an enzyme family with peroxidase activity whose main biological role is to protect the organism from oxidative damage. The biochemical function of glutathione peroxidase is to reduce lipid hydroperoxides to their corresponding alcohols and to reduce free hydrogen peroxide to water. There are several isozymes encoded by different genes, which vary in celullar location and substrate specificity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPX7