Glutamate Receptor 6 Antibody

Images

 
Western Blot: Glutamate Receptor 6 Antibody [NBP2-87512] - Host: Rabbit. Target Name: GRIK2. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutamate Receptor 6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human Glutamate Receptor 6. Peptide sequence: LGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GRIK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutamate Receptor 6 Antibody

  • EAA4
  • glutamate receptor 6
  • glutamate receptor, ionotropic, kainate 2
  • ionotropic kainate 2
  • MGC74427

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76853
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22399
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-61782
Species: Hu
Applications: WB, ELISA, ICC/IF
NLS921
Species: Hu, Bv
Applications: WB, IHC, IHC-P, ICC
NLS3208
Species: Hu, Po, Bv, Eq, Pm, Pm
Applications: WB, IHC, IHC-P, ICC
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00004296-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76852
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP2-67800
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Glutamate Receptor 6 Antibody (NBP2-87512) (0)

There are no publications for Glutamate Receptor 6 Antibody (NBP2-87512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutamate Receptor 6 Antibody (NBP2-87512) (0)

There are no reviews for Glutamate Receptor 6 Antibody (NBP2-87512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutamate Receptor 6 Antibody (NBP2-87512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Glutamate Receptor 6 Products

Bioinformatics Tool for Glutamate Receptor 6 Antibody (NBP2-87512)

Discover related pathways, diseases and genes to Glutamate Receptor 6 Antibody (NBP2-87512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutamate Receptor 6 Antibody (NBP2-87512)

Discover more about diseases related to Glutamate Receptor 6 Antibody (NBP2-87512).
 

Pathways for Glutamate Receptor 6 Antibody (NBP2-87512)

View related products by pathway.

PTMs for Glutamate Receptor 6 Antibody (NBP2-87512)

Learn more about PTMs related to Glutamate Receptor 6 Antibody (NBP2-87512).

Blogs on Glutamate Receptor 6

There are no specific blogs for Glutamate Receptor 6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutamate Receptor 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIK2