Glut2 Recombinant Protein Antigen

Images

 
There are currently no images for Glut2 Recombinant Protein Antigen (NBP3-24872PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glut2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glut2

Source: E.coli

Amino Acid Sequence: RLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYRQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC2A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24872It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glut2 Recombinant Protein Antigen

  • GLUT2 Glucose transporter type 2, liver
  • Glut2
  • GLUT-2
  • SLC2A2
  • solute carrier family 2 (facilitated glucose transporter), member 2
  • solute carrier family 2, facilitated glucose transporter member 2

Background

Glucose transporters are integral membrane glycoproteins involved in transporting glucose into most cells. Seven types of glucose transport carrier proteins, designated as Glut 1 to 7, facilitate glucose transport across the cell membrane. Molecular cloning of glucose transporters have identified a family of closely related genes that encode at least 7 proteins exhibiting high degree of amino acid homology (45% to 65%), all in the molecular weight range of 40 to 60 kDa. Individual members of the Glut family have predicted secondary structure characteristic of 12 membrane spanning domains of other transport carriers. The majority of differences in sequence homology in Glut proteins occur at 4 hydrophilic domains that may play a role in distinct tissue specific pattern of expression and targeting. All Glut proteins are glycosylated at or near the C terminus and are present on either cell surface or in intracellular sites. Some transporters exhibit dynamic trafficking between intracellular storage sites and plasma membranes in response to various stimuli. In some tissues Glut proteins are asymmetrically distributed between apical and basolateral membranes as in blood brain barrier and blood testis barriers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-47980
Species: Hu, Pm
Applications: Flow, IHC,  IHC-P, IP, WB
MAB1415
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-84079
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13390
Species: Hu
Applications: IHC,  IHC-P
NBP2-12793
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-49672
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
NBP3-44193
Species: Hu
Applications:  IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
MAB6347
Species: Hu
Applications: WB
NBP3-24872PEP
Species: Hu
Applications: AC

Publications for Glut2 Recombinant Protein Antigen (NBP3-24872PEP) (0)

There are no publications for Glut2 Recombinant Protein Antigen (NBP3-24872PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut2 Recombinant Protein Antigen (NBP3-24872PEP) (0)

There are no reviews for Glut2 Recombinant Protein Antigen (NBP3-24872PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glut2 Recombinant Protein Antigen (NBP3-24872PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glut2 Products

Research Areas for Glut2 Recombinant Protein Antigen (NBP3-24872PEP)

Find related products by research area.

Blogs on Glut2.

Deficiency of GluT1 leads to neurological problems while excess is involved in cancers
By Jamshed Arslan, Pharm. D., PhD. What Are GluTs?Mammalian cell metabolism is incomplete without glucose   . Glucose is a monosaccharide that is transported to the cells through facilitative diffusion, a ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glut2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A2