Glut2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Glut2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glut2
  
  

  Source: E.coli

  Amino Acid Sequence: RLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYRQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SLC2A2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24872It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glut2 Recombinant Protein Antigen

• GLUT2 Glucose transporter type 2, liver
• Glut2
• GLUT-2
• SLC2A2
• solute carrier family 2 (facilitated glucose transporter), member 2
• solute carrier family 2, facilitated glucose transporter member 2

Background

Glucose transporters are integral membrane glycoproteins involved in transporting glucose into most cells. Seven types of glucose transport carrier proteins, designated as Glut 1 to 7, facilitate glucose transport across the cell membrane. Molecular cloning of glucose transporters have identified a family of closely related genes that encode at least 7 proteins exhibiting high degree of amino acid homology (45% to 65%), all in the molecular weight range of 40 to 60 kDa. Individual members of the Glut family have predicted secondary structure characteristic of 12 membrane spanning domains of other transport carriers. The majority of differences in sequence homology in Glut proteins occur at 4 hydrophilic domains that may play a role in distinct tissue specific pattern of expression and targeting. All Glut proteins are glycosylated at or near the C terminus and are present on either cell surface or in intracellular sites. Some transporters exhibit dynamic trafficking between intracellular storage sites and plasma membranes in response to various stimuli. In some tissues Glut proteins are asymmetrically distributed between apical and basolateral membranes as in blood brain barrier and blood testis barriers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC2A2