Glucagon R/GCGR Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glucagon R/GCGR. Source: E. coli Amino Acid Sequence: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GCGR |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55921. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Glucagon R/GCGR Recombinant Protein Antigen
Background
Glucagon, a pancreatic hormone, functions as an antagonist to insulin, stimulating the conversion of glycogen to glucose and increasing blood sugar levels. GLP-1 functions as a transmitter in the central nervous system, inhibiting feeding and drinking behavior. Both glucagon and GLP-1 function through their specific binding to the glucagon receptor or GLP-1R, respectively. The glucagon receptor shows expression in liver, kidney and adipose tissue. The 56 GLP-1R expression primarily localizes to areas of the hypothalamus involved in feeding behavior. Both receptors and their ligands serve as potential targets for the therapeutic treatment of diabetes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Po, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP) (0)
There are no publications for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP) (0)
There are no reviews for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP) (0)
Additional Glucagon R/GCGR Products
Research Areas for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP)
Find related products by research area.
|
Blogs on Glucagon R/GCGR