GliS2 Antibody

Western Blot: GliS2 Antibody [NBP2-54964] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunocytochemistry/Immunofluorescence: GliS2 Antibody [NBP2-54964] - Staining of human cell line HeLa shows localization to nucleoplasm, plasma membrane & cytosol.

Product Discontinued

GliS2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNAR
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLIS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GliS2 Antibody

• GLIS family zinc finger 2
• NKL
• zinc finger protein GLIS2

Background

Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLIS2