Glis1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VLTECLVLQQLHTSTQLAASDGKGGCGLGQELLPGVYPGSITPHNGLASGLLPPAHNVPSRHHPLDATTSSHHHLSPLPMAESTRDGLGPGLLSPIVSPLKGLGPPPLPPSSQSHSPGGQPFPTLP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GLIS1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Glis1 Antibody
Background
GLIS1 is a GLI (MIM 165220)-related Kruppel-like zinc finger protein that functions as an activator and repressor oftranscription (Kim et al., 2002 (PubMed 12042312)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: IHC, IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Mu
Applications: ChIP, ICC, IHC, WB
Publications for Glis1 Antibody (NBP1-83492) (0)
There are no publications for Glis1 Antibody (NBP1-83492).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glis1 Antibody (NBP1-83492) (0)
There are no reviews for Glis1 Antibody (NBP1-83492).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Glis1 Antibody (NBP1-83492) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glis1 Products
Blogs on Glis1