GLIPR1L1 Antibody

Images

 
Immunohistochemistry-Paraffin: GLIPR1L1 Antibody [NBP1-82722] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLIPR1L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLIPR1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Bladder Lysate (NB820-59467)
Control Peptide
GLIPR1L1 Protein (NBP1-82722PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLIPR1L1 Antibody

  • ALKN2972
  • GLI pathogenesis-related 1 like 1
  • GLIPR1-like protein 1
  • MGC26856
  • PRO7434

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4468
Species: Mu
Applications: WB
NBP1-81091
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
NBL1-14964
Species: Hu
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83792
Species: Hu
Applications: IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
NBP1-82722
Species: Hu
Applications: IHC, IHC-P

Publications for GLIPR1L1 Antibody (NBP1-82722) (0)

There are no publications for GLIPR1L1 Antibody (NBP1-82722).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLIPR1L1 Antibody (NBP1-82722) (0)

There are no reviews for GLIPR1L1 Antibody (NBP1-82722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GLIPR1L1 Antibody (NBP1-82722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional GLIPR1L1 Products

Bioinformatics Tool for GLIPR1L1 Antibody (NBP1-82722)

Discover related pathways, diseases and genes to GLIPR1L1 Antibody (NBP1-82722). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLIPR1L1 Antibody (NBP1-82722)

Discover more about diseases related to GLIPR1L1 Antibody (NBP1-82722).
 

Pathways for GLIPR1L1 Antibody (NBP1-82722)

View related products by pathway.

PTMs for GLIPR1L1 Antibody (NBP1-82722)

Learn more about PTMs related to GLIPR1L1 Antibody (NBP1-82722).
 

Research Areas for GLIPR1L1 Antibody (NBP1-82722)

Find related products by research area.

Blogs on GLIPR1L1

There are no specific blogs for GLIPR1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLIPR1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLIPR1L1