GLI-3 Antibody

Images

 
Immunohistochemistry-Paraffin: GLI-3 Antibody [NBP1-89275] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: GLI-3 Antibody [NBP1-89275] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: GLI-3 Antibody [NBP1-89275] - Staining of human spleen shows moderate to strong nuclear positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLI-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLI3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
GLI-3 Protein (NBP1-89275PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLI-3 Antibody

  • ACLS
  • ACLSPAPAPHS
  • ADD
  • Bph
  • GCPS
  • GLI family zinc finger 3
  • GLI3 form of 190 kDa
  • GLI3 full length protein
  • GLI3
  • GLI-3
  • GLI3-190
  • GLI3FL
  • GLI-Kruppel family member GLI3
  • glioma-associated oncogene family zinc finger 3
  • Greig cephalopolysyndactyly syndrome
  • oncogene GLI3
  • PAP-A
  • PAPA1
  • PAPB
  • PAPBDNA-binding protein
  • Pdn
  • PHS
  • PPDIV
  • Xt
  • zinc finger protein GLI3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for GLI-3 Antibody (NBP1-89275) (0)

There are no publications for GLI-3 Antibody (NBP1-89275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-3 Antibody (NBP1-89275) (0)

There are no reviews for GLI-3 Antibody (NBP1-89275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GLI-3 Antibody (NBP1-89275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLI-3 Products

Bioinformatics Tool for GLI-3 Antibody (NBP1-89275)

Discover related pathways, diseases and genes to GLI-3 Antibody (NBP1-89275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-3 Antibody (NBP1-89275)

Discover more about diseases related to GLI-3 Antibody (NBP1-89275).
 

Pathways for GLI-3 Antibody (NBP1-89275)

View related products by pathway.

PTMs for GLI-3 Antibody (NBP1-89275)

Learn more about PTMs related to GLI-3 Antibody (NBP1-89275).
 

Research Areas for GLI-3 Antibody (NBP1-89275)

Find related products by research area.

Blogs on GLI-3

There are no specific blogs for GLI-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLI-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI3
Entrez