GKAP/DLGAP1 Antibody - BSA Free

Staining of human cell line U2OS shows localization to cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GKAP/DLGAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GKAP/DLGAP1 Antibody - BSA Free (NBP3-24868) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein GKAP/DLGAP1 using the following amino acid sequence: MKALTAAIEAANAQIHGPASQHMGNNTATVTTTTTIATVTTEDRKKDHFKKNRCLSIGIQVDDAEEPDKTGENKAPSKFQS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLGAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GKAP/DLGAP1 Antibody - BSA Free

• DAP1
• DAP-1-ALPHA
• DAP-1DAP-1-BETA
• discs, large (Drosophila) homolog-associated protein 1
• disks large-associated protein 1
• DLGAP1
• GKAP
• GKAPMGC88156
• hGKAP
• PSD-95/SAP90 binding protein 1
• PSD-95/SAP90-binding protein 1
• SAP90/PSD-95-associated protein 1
• SAPAP1
• SAPAP1Guanylate kinase-associated protein

Background

Members of the postsynaptic density-95 (PSD-95)/SAP90 family of membraneassociated guanylate kinase (MAGUK) proteins function as multimodular scaffolds that organize protein-signaling complexes at neuronal synapses. PSD-95/SAP90 binds guanylate kinase-associated protein (GKAP), also designated GK domain-binding protein, DAP-1-alpha, DAP-1-beta, PSD-95 binding protein, PSD-95/SAP90 associated protein, or SAPAP1, through the guanylate kinase domain. SAPAP1 is expressed widely in neurons of the cortex and hippocampus and in the Purkinje and granule cells of the cerebellum. N-terminal splice variants of SAPAP1 are expressed as 95 and 130 kDa proteins. SAPAP1 is localized specifically in the PSD of glutamatergic synapses, consistent with its direct interaction with PSD-95 family proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLGAP1