Recombinant Mouse GITR Ligand/TNFSF18 Protein

Images

 
Functional: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - Demonstration of the potency of Fc-mGITRL in comparison to an agonist anti-mGITR antibody (IMG-5920A, clone DTA-1) and anti-CD28 in the presence ...read more
SDS-Page: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - SDS-PAGE analysis of recombinant Fc-mGITRL to demonstrate purity of protein.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications Func, PAGE
Concentration
2 mg/ml

Order Details

Recombinant Mouse GITR Ligand/TNFSF18 Protein Summary

Description
A recombinant protein corresponding to TNFSF18.

Amino Acid Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS.

Human IgG Fc in italics

Extracellular domain of murine GITRL is underlined

Details of Functionality
In vitro proliferation assay, in vivo assays.
Protein/Peptide Type
Recombinant Protein
Gene
TNFSF18
Purity
Protein A purified
Endotoxin Note
Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.

Applications/Dilutions

Dilutions
  • Functional reported in scientific literature (PMID 24633226)
  • In vitro assay reported in scientific literature (PMID 24633226)
  • SDS-Page
Theoretical MW
39.78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP2-26579 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized.
Concentration
2 mg/ml
Purity
Protein A purified

Alternate Names for Recombinant Mouse GITR Ligand/TNFSF18 Protein

  • Activation-inducible TNF-related ligand
  • AITRL
  • AITRLMGC138237
  • GITR Ligand
  • GITRL
  • GITRLglucocorticoid-induced TNFR-related protein ligand
  • Glucocorticoid-induced TNF-related ligand
  • hGITRLGITR ligand
  • TL6AITR ligand
  • TNFSF18
  • tumor necrosis factor (ligand) superfamily, member 18
  • tumor necrosis factor ligand superfamily member 18

Background

The Glucocorticoid- Induced TNFR -Related gene (GITR) is a newly identified member of Tumor Necrosis factor Receptor Super Family (TNFRSF). The cytoplasmic domain of GITR is highly homologous to other TNFRSF members such as CD137, OX40 and CD40. The ligand for GITR is GITRL, which is a type II transmembrane protein that is normally expressed on the surface of antigen presenting cells, including macrophages and dendrtic cells. The cell surface marker GITR has been shown to be constitutively expressed at high levels on the surface of murine CD4+/CD25+ cells, known as Treg cells, and also up regulated on activated CD4+ and CD8+ cells. Treg cells have a clearly established immunosuppressive role capable of thwarting the host immune response to tumors. Functionally, GITR has been described as an co-stimulatory receptor that promotes survival in early phases of T-cell activation The process through which GITR induces co-stimulation is complex, entailing IL-2 as well as counter-regulatory IL-10 production. High doses of IL-2 have been reported to produce Treg cell proliferation while rendering Treg cells less effective at their suppressive function. Though GITR is present on both effector T-cells and immunosuppressive Treg cells, the effects of the receptors ligation and signaling may differ between the two subpopulations. GITRL is known to produce a state of activation, perhaps by directly or indirectly abrogating the suppressive function of Treg cells, by activating effector T-cells, or perhaps through both mechanism. Fc-GITRL has been used effectively to eradicate solid tumors in mice in vivo. The use of the physiologic ligand to GITR may have advantages over the use of an agonist antibody, such as DTA-1, in that it's small size may have better tumor penetration, more favorable half-life kinetics, and more effective co-stimultaory activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB689
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DCDL40
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
DR2A00
Species: Hu
Applications: ELISA
NBP2-16996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
MAB10541
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
485-MI
Species: Mu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF1246
Species: Mu
Applications: WB
462-TEC
Species: Mu
Applications: BA
MAB2738
Species: Hu
Applications: Flow
AF1028
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
1896-TL
Species: Mu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-26579
Species: Mu
Applications: Func, PAGE
Supplier Logo

Publications for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: Func, In vitro.


Filter By Application
Func
(1)
In vitro
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579) (0)

There are no reviews for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579). (Showing 1 - 1 of 1 FAQs).

  1. Could you let me know the expression cell of this recombinant protein?
    • The actual cell line(s) that was used is considered a proprietary information, and therefore could be be revealed.

Additional GITR Ligand/TNFSF18 Products

Research Areas for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579)

Find related products by research area.

Blogs on GITR Ligand/TNFSF18

There are no specific blogs for GITR Ligand/TNFSF18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Mouse GITR Ligand/TNFSF18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF18