Functional: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - Demonstration of the potency of Fc-mGITRL in comparison to an agonist anti-mGITR antibody (IMG-5920A, clone DTA-1) and anti-CD28 in the presence ...read more
SDS-Page: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - SDS-PAGE analysis of recombinant Fc-mGITRL to demonstrate purity of protein.
Recombinant Mouse GITR Ligand/TNFSF18 Protein Summary
Description
A recombinant protein corresponding to TNFSF18.
Amino Acid Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS. Human IgG Fc in italics Extracellular domain of murine GITRL is underlined
Details of Functionality
In vitro proliferation assay, in vivo assays.
Protein/Peptide Type
Recombinant Protein
Gene
TNFSF18
Purity
Protein A purified
Endotoxin Note
Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.
Applications/Dilutions
Dilutions
Functional reported in scientific literature (PMID 24633226)
In vitro assay reported in scientific literature (PMID 24633226)
SDS-Page
Theoretical MW
39.78 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP2-26579 in the following applications:
Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized.
Concentration
2 mg/ml
Purity
Protein A purified
Alternate Names for Recombinant Mouse GITR Ligand/TNFSF18 Protein
Activation-inducible TNF-related ligand
AITRL
AITRLMGC138237
GITR Ligand
GITRL
GITRLglucocorticoid-induced TNFR-related protein ligand
Glucocorticoid-induced TNF-related ligand
hGITRLGITR ligand
TL6AITR ligand
TNFSF18
tumor necrosis factor (ligand) superfamily, member 18
tumor necrosis factor ligand superfamily member 18
Background
The Glucocorticoid- Induced TNFR -Related gene (GITR) is a newly identified member of Tumor Necrosis factor Receptor Super Family (TNFRSF). The cytoplasmic domain of GITR is highly homologous to other TNFRSF members such as CD137, OX40 and CD40. The ligand for GITR is GITRL, which is a type II transmembrane protein that is normally expressed on the surface of antigen presenting cells, including macrophages and dendrtic cells. The cell surface marker GITR has been shown to be constitutively expressed at high levels on the surface of murine CD4+/CD25+ cells, known as Treg cells, and also up regulated on activated CD4+ and CD8+ cells. Treg cells have a clearly established immunosuppressive role capable of thwarting the host immune response to tumors. Functionally, GITR has been described as an co-stimulatory receptor that promotes survival in early phases of T-cell activation The process through which GITR induces co-stimulation is complex, entailing IL-2 as well as counter-regulatory IL-10 production. High doses of IL-2 have been reported to produce Treg cell proliferation while rendering Treg cells less effective at their suppressive function. Though GITR is present on both effector T-cells and immunosuppressive Treg cells, the effects of the receptors ligation and signaling may differ between the two subpopulations. GITRL is known to produce a state of activation, perhaps by directly or indirectly abrogating the suppressive function of Treg cells, by activating effector T-cells, or perhaps through both mechanism. Fc-GITRL has been used effectively to eradicate solid tumors in mice in vivo. The use of the physiologic ligand to GITR may have advantages over the use of an agonist antibody, such as DTA-1, in that it's small size may have better tumor penetration, more favorable half-life kinetics, and more effective co-stimultaory activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.
Reviews for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579) (0)
There are no reviews for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GITR Ligand/TNFSF18 Recombinant Protein (NBP2-26579). (Showing 1 - 1 of 1 FAQs).
Could you let me know the expression cell of this recombinant protein?
The actual cell line(s) that was used is considered a proprietary information, and therefore could be be revealed.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Recombinant Mouse GITR Ligand/TNFSF18 Protein and receive a gift card or discount.