Home » GITR Ligand/TNFSF18 » GITR Ligand/TNFSF18 Antibodies » GITR Ligand/TNFSF18 Antibody (6F7)

GITR Ligand/TNFSF18 Antibody (6F7)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: GITR Ligand/TNFSF18 Antibody (6F7) [H00008995-M01] - Detection limit for recombinant GST tagged TNFSF18 is approximately 1ng/ml as a capture antibody.
Sandwich ELISA: GITR Ligand/TNFSF18 Antibody (6F7) [H00008995-M01] - Detection limit for recombinant GST tagged TNFSF18 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GITR Ligand/TNFSF18 Antibody (6F7) Summary

Immunogen
TNFSF18 (NP_005083 68 a.a. - 177 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Specificity
TNFSF18 (6F7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNFSF18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GITR Ligand/TNFSF18 Antibody (6F7)

  • Activation-inducible TNF-related ligand
  • AITRLMGC138237
  • GITR Ligand
  • GITRL
  • GITRLglucocorticoid-induced TNFR-related protein ligand
  • Glucocorticoid-induced TNF-related ligand
  • hGITRLGITR ligand
  • TL6AITR ligand
  • TNFSF18
  • tumor necrosis factor (ligand) superfamily, member 18
  • tumor necrosis factor ligand superfamily member 18

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GITR/TNFRSF18
Antibody (110416) [Un ...
MAB689
GITR/TNFRSF18 Antibody (110416) [Unconjugated]
(1 Review)
(9 Publications)
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(506 Publications)
Species: Hu
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
(7 Reviews)
(13 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
ISG20 Antibody
(1B2-3C9)
H00003669-M01
Western Blot: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of ISG20 expression in transfected 293T cell line by ISG20 monoclonal antibody (M01), clone 1B2-3C9.Lane 1: ISG20 transfected lysate(20.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of monoclonal antibody to ISG20 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Detection limit for recombinant GST tagged ISG20 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
IL-2 [Unconjugated]
202-IL
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
(11 Reviews)
(232 Publications)
Species: Hu
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of human breast tumor tissue using an isotype control antibody (top) and p50 antibody (bottom) at 5 ug/ml.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC-P
FoxP3 Antibody
NB100-39002
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Mouse spleen stained with FoxP3 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Analysis of a formalin fixed paraffin embedded tissue section of human tonsil using 1:200 dilution of rabbit anti-FoxP3 antibody. The staining was developed with HRP labeled anti-rabbit IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This FoxP3 antibody generated an expected and a specific nuclear staining of FOXP3 in a subset of cells which are potentially the Treg cells.
Immunohistochemistry: FoxP3 Antibody [NB100-39002] - Antibody was tested in mouse spleen using DAB with hematoxylin counterstain.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
OX40 Ligand/TNFSF4
Antibody (159403) [Un ...
MAB10541
OX40 Ligand/TNFSF4 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with LPS using Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody (Catalog # MAB10541) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (orange; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Human mature dentritic cells differentated from human peripheral blood mononuclear cell derived CD14+ cells treated with 20 ng/mL Recombinant Human IL‑4 (Catalog # 204-IL) and 50 ng/mL Recombinant Human GM‑CSF (Catalog # 215-GM) for 7 days and 1 μg/mL LPS, 20 ng/mL Recombinant Human TNF‑ alpha (Catalog # 210-TA), and 20 ng/mL Recombinant Human IL‑1 beta /IL‑1F2 (Catalog # 201-LB) for last 24 hours were stained with Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody(Catalog # MAB10541, filled histogram) or isotype control (Catalog # MAB002, open histogram), followed by Goat F(ab)2 Anti-Mouse IgG (H+L) Allophycocyanin (Catalog # F0101B).
Recombinant Human OX40 Ligand/TNFSF4 (Catalog # 1054-OX) induces IL‑8 secretion in the HT1080 human fibrosarcoma cell line transfected with human OX40 in a dose-dependent manner (orange line) as measured by Human IL‑8 Duoset (Catalog # DY208). IL‑8 Secretion elicited by Recombinant Human OX40 Ligand/TNFSF4 (10 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human OX40 Ligand/TNFSF4 Monoclonal Antibody (Catalog # MAB10541). The ND50 is typically 0.1-0.6  μg/mL.
(4 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(5 Reviews)
(250 Publications)
Species: Hu
CD8 alpha Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/ml and incubated for 3 hours at room temperature.
Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.
Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(11 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Recombinant Mouse
4-1BB Ligand/TNFSF9 P ...
NBP2-26580
Functional: Recombinant Mouse 4-1BB Ligand/TNFSF9 Protein [NBP2-26580] - Demonstration of the potency of mCD137L fusion protein in vitro in comparison to an agonist antibody 2A. Balb/c mouse splenocytes were incubated for 48 hrs on anti-CD3 (145-11C clone) monoclonal antibody coated plates in the presence of 2 mg/ml anti-CD3, 2A or Fc-mCD137L. The amount of IL-2 production induced by Fc-mCD137L was comparable to the induction by 2A antibody.
SDS-Page: Recombinant Mouse 4-1BB Ligand/TNFSF9 Protein [NBP2-26580] - Electrophoretic analysis of the purified Fc-mCD137L using Coomassie Blue stained 4-20% reducing SDS-PAGE.
(1 Publication)
Species: Mu

TRANCE/TNFSF11/RANK L
462-TR
1 μg/lane of Recombinant Mouse TRANCE/TNFSF11/RANK L was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 36 kDa.
Recombinant Mouse TRANCE/TNFSF11/RANK L (Catalog # 462-TR) induces osteoclast differentiation of the RAW 264.7 mouse monocyte/macrophage cell line. The ED50 for this effect is 5‑15 ng/mL in the presence of 2.5 μg/mL of a cross-linking antibody, Mouse Anti-polyHistidine Monoclonal Antibody (Catalog # MAB050)
(55 Publications)
Species: Mu
CD27
Ligand/TNFSF7/CD70 An ...
MAB2738
CD27 Ligand/TNFSF7 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human CD27 Ligand/TNFSF7 Monoclonal Antibody (Catalog # MAB2738) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, ICC
CD30 Ligand/TNFSF8
Antibody [Unconjugate ...
AF1028
CD30 Ligand/TNFSF8 was detected in immersion fixed paraffin-embedded sections of human thymus using Goat Anti-Human CD30 Ligand/TNFSF8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1028) at 0.3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to Hassall's corpuscles. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
CD30 Ligand/TNFSF8 was detected in immersion fixed paraffin-embedded sections of human placenta using Goat Anti-Human CD30 Ligand/TNFSF8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1028) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to endothelial cells in villi. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
TL1A/TNFSF15
Antibody (2116C) - Az ...
MAB7442
Western Blot: TL1A/TNFSF15 Antibody (2116C) [MAB7442] - Analysis of human prostate, kidney, and lung tissue lysates with 1 ug/ml of hTL1A Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hTL1A at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, B/N
CTLA-4 Antibody
[Unconjugated]
AF-386-PB
Western blot shows lysates of NS0 mouse myeloma cell line either mock transfected or transfected with human CTLA-4. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for CTLA‑4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NS0 mouse myeloma cell line co-transfected with human CTLA-4 and eGFP was stained with either (A) Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
CTLA‑4 was detected in immersion fixed human peripheral blood mononuclear cells treated with treated with PMA and calcium ionomycin using Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)

There are no publications for GITR Ligand/TNFSF18 Antibody (H00008995-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)

There are no reviews for GITR Ligand/TNFSF18 Antibody (H00008995-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Discover related pathways, diseases and genes to GITR Ligand/TNFSF18 Antibody (H00008995-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Discover more about diseases related to GITR Ligand/TNFSF18 Antibody (H00008995-M01).
 

Pathways for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

View related products by pathway.

PTMs for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Learn more about PTMs related to GITR Ligand/TNFSF18 Antibody (H00008995-M01).
 

Research Areas for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Find related products by research area.

Blogs on GITR Ligand/TNFSF18

There are no specific blogs for GITR Ligand/TNFSF18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GITR Ligand/TNFSF18 Antibody (6F7) and receive a gift card or discount.


Bioinformatics

Gene Symbol TNFSF18
Entrez
OMIM
Uniprot