GITR Ligand/TNFSF18 Antibody (6F7)

Images

 
Sandwich ELISA: GITR Ligand/TNFSF18 Antibody (6F7) [H00008995-M01] - Detection limit for recombinant GST tagged TNFSF18 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GITR Ligand/TNFSF18 Antibody (6F7) Summary

Immunogen
TNFSF18 (NP_005083 68 a.a. - 177 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Specificity
TNFSF18 (6F7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNFSF18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GITR Ligand/TNFSF18 Antibody (6F7)

  • Activation-inducible TNF-related ligand
  • AITRLMGC138237
  • GITR Ligand
  • GITRL
  • GITRLglucocorticoid-induced TNFR-related protein ligand
  • Glucocorticoid-induced TNF-related ligand
  • hGITRLGITR ligand
  • TL6AITR ligand
  • TNFSF18
  • tumor necrosis factor (ligand) superfamily, member 18
  • tumor necrosis factor ligand superfamily member 18

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF2738
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1028
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB7442
Species: Hu
Applications: WB, B/N

Publications for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)

There are no publications for GITR Ligand/TNFSF18 Antibody (H00008995-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)

There are no reviews for GITR Ligand/TNFSF18 Antibody (H00008995-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Discover related pathways, diseases and genes to GITR Ligand/TNFSF18 Antibody (H00008995-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Discover more about diseases related to GITR Ligand/TNFSF18 Antibody (H00008995-M01).
 

Pathways for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

View related products by pathway.

PTMs for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Learn more about PTMs related to GITR Ligand/TNFSF18 Antibody (H00008995-M01).
 

Research Areas for GITR Ligand/TNFSF18 Antibody (H00008995-M01)

Find related products by research area.

Blogs on GITR Ligand/TNFSF18

There are no specific blogs for GITR Ligand/TNFSF18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GITR Ligand/TNFSF18 Antibody (6F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF18
Entrez
OMIM
Uniprot