GITR Ligand/TNFSF18 Antibody (6F7) Summary
| Immunogen |
TNFSF18 (NP_005083 68 a.a. - 177 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
| Specificity |
TNFSF18 (6F7) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TNFSF18 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GITR Ligand/TNFSF18 Antibody (6F7)
Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rb
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, B/N
Publications for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)
There are no publications for GITR Ligand/TNFSF18 Antibody (H00008995-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)
There are no reviews for GITR Ligand/TNFSF18 Antibody (H00008995-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
- 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GITR Ligand/TNFSF18 Antibody (H00008995-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Array Products
Bioinformatics Tool for GITR Ligand/TNFSF18 Antibody (H00008995-M01)
Discover related pathways, diseases and genes to GITR Ligand/TNFSF18 Antibody (H00008995-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GITR Ligand/TNFSF18 Antibody (H00008995-M01)
Discover more about diseases related to GITR Ligand/TNFSF18 Antibody (H00008995-M01).
| | Pathways for GITR Ligand/TNFSF18 Antibody (H00008995-M01)
View related products by pathway.
|
PTMs for GITR Ligand/TNFSF18 Antibody (H00008995-M01)
Learn more about PTMs related to GITR Ligand/TNFSF18 Antibody (H00008995-M01).
| | Research Areas for GITR Ligand/TNFSF18 Antibody (H00008995-M01)
Find related products by research area.
|
Blogs on GITR Ligand/TNFSF18
![Sandwich ELISA: GITR Ligand/TNFSF18 Antibody (6F7) [H00008995-M01] - Detection limit for recombinant GST tagged TNFSF18 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/GITR Ligand-TNFSF18 Antibody (6F7)-Sandwich ELISA-H00008995-M01-img0002.jpg "Sandwich ELISA: GITR Ligand/TNFSF18 Antibody (6F7) [H00008995-M01] - Detection limit for recombinant GST tagged TNFSF18 is approximately 1ng/ml as a capture antibody.")
![GITR/TNFRSF18 Antibody (110416) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "GITR/TNFRSF18 Antibody (110416) [Unconjugated]")
![Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.](http://images.novusbio.com/fullsize2/CD4-Antibody-Western-Blot-NBP1-19371-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize2/CD4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-19371-img0005.jpg)
![Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.](http://images.novusbio.com/fullsize2/CD4-Antibody-Immunohistochemistry-Frozen-NBP1-19371-img0013.jpg)
![Western Blot: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of ISG20 expression in transfected 293T cell line by ISG20 monoclonal antibody (M01), clone 1B2-3C9.Lane 1: ISG20 transfected lysate(20.4 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/ISG20 Antibody (1B2-3C9)-Western Blot-H00003669-M01-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of monoclonal antibody to ISG20 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/ISG20-Antibody-(1B2-3C9)-Immunocytochemistry-Immunofluorescence-H00003669-M01-img0006.jpg)
![Sandwich ELISA: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Detection limit for recombinant GST tagged ISG20 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/ISG20-Antibody-(1B2-3C9)-Sandwich-ELISA-H00003669-M01-img0007.jpg)
![Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.](http://images.novusbio.com/fullsize2/NFkB-p105-p50-Antibody-(2J10D7)-Western-Blot-NB100-56583-img0004.jpg)
![Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review](http://images.novusbio.com/fullsize2/NFkB-p105-p50-Antibody-(2J10D7)-Immunohistochemistry-Paraffin-NB100-56583-img0009.jpg)
![Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.](http://images.novusbio.com/fullsize2/NFkB-p105-p50-Antibody-(2J10D7)-Flow-Cytometry-NB100-56583-img0008.jpg)
![Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Mouse spleen stained with FoxP3 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize2/FoxP3-Antibody-Immunohistochemistry-Paraffin-NB100-39002-img0011.jpg)
![Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - FFPE tissue section of human tonsil using 1:200 dilution of rabbit anti-FoxP3 antibody. The staining was developed with HRP-labeled anti-rabbit IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This FoxP3 antibody generated an expected and a specific nuclear staining of FOXP3 in a subset of cells which are potentially the Treg cells.](http://images.novusbio.com/fullsize2/FoxP3-Antibody-Immunohistochemistry-Paraffin-NB100-39002-img0017.jpg)
![Immunohistochemistry: FoxP3 Antibody [NB100-39002] - Antibody was tested in mouse spleen using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/FoxP3-Antibody-Immunohistochemistry-NB100-39002-img0014.jpg)
![In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.](http://images.novusbio.com/fullsize2/TNFSF4-Protein-In-vitro-assay-NBP2-26577-img0001.jpg)
![SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.](http://images.novusbio.com/fullsize2/TNFSF4-Protein-SDS-Page-NBP2-26577-img0002.jpg)
![SDS-Page: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-15% reducing SDS-PAGE.](http://images.novusbio.com/fullsize2/Recombinant-Mouse-OX40-Ligand-TNFSF4-Protein-SDS-Page-NBP2-26577-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.](http://images.novusbio.com/fullsize2/CD8-alpha-Antibody-(53-6.7)-Immunocytochemistry-NBP1-49045-img0011.jpg)
![Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.](http://images.novusbio.com/fullsize2/CD8-alpha-Antibody-(53-6.7)-Immunohistochemistry-Frozen-NBP1-49045-img0015.jpg)
![Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.](http://images.novusbio.com/fullsize2/CD8-alpha-Antibody-(53-6.7)-Flow-Cytometry-NBP1-49045-img0014.jpg)
![Functional: Recombinant Mouse 4-1BB Ligand/TNFSF9 Protein [NBP2-26580] - Demonstration of the potency of mCD137L fusion protein in vitro in comparison to an agonist antibody 2A. Balb/c mouse splenocytes were incubated for 48 hrs on anti-CD3 (145-11C clone) monoclonal antibody coated plates in the presence of 2 mg/ml anti-CD3, 2A or Fc-mCD137L. The amount of IL-2 production induced by Fc-mCD137L was comparable to the induction by 2A antibody.](http://images.novusbio.com/fullsize2/Recombinant-Mouse-4-1BB-Ligand-TNFSF9-Protein-Functional-NBP2-26580-img0003.jpg)
![SDS-Page: Recombinant Mouse 4-1BB Ligand/TNFSF9 Protein [NBP2-26580] - Electrophoretic analysis of the purified Fc-mCD137L using Coomassie Blue stained 4-20% reducing SDS-PAGE.](http://images.novusbio.com/fullsize2/Recombinant-Mouse-4-1BB-Ligand-TNFSF9-Protein-SDS-Page-NBP2-26580-img0002.jpg)
![Western Blot: TL1A/TNFSF15 Antibody (2116C) [MAB7442] - Analysis of human prostate, kidney, and lung tissue lysates with 1 ug/ml of hTL1A Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hTL1A at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.](http://images.novusbio.com/fullsize2/TL1A-TNFSF15-Antibody-(2116C)-Western-Blot-MAB7442-img0001.jpg)
![SDS-Page: Mouse IgG2a Native Protein [NBP1-96981] - SDS-PAGE of Mouse IgG2a Kappa Isotype Control. Lane 1: Mouse IgG2a Kappa Isotype Control, Non-reduced. M: Opal Pre-stained Ladder. Lane 2: Mouse IgG2a Kappa Isotype Control, Reduced. Load: 1.0 ug per lane. Predicted/Observed: 140 kDa Non-reduced, 55 and 25 Reduced.](http://images.novusbio.com/images2/Mouse IgG2a Native Protein-SDS-Page-NBP1-96981-img0003.jpg "SDS-Page: Mouse IgG2a Native Protein [NBP1-96981] - SDS-PAGE of Mouse IgG2a Kappa Isotype Control. Lane 1: Mouse IgG2a Kappa Isotype Control, Non-reduced. M: Opal Pre-stained Ladder. Lane 2: Mouse IgG2a Kappa Isotype Control, Reduced. Load: 1.0 ug per lane. Predicted/Observed: 140 kDa Non-reduced, 55 and 25 Reduced.")
![Functional: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - Demonstration of the potency of Fc-mGITRL in comparison to an agonist anti-mGITR antibody (IMG-5920A, clone DTA-1) and anti-CD28 in the presence of anti-CD3. Anti-CD3 antibody serves as a negative control for co-stimulation.](http://images.novusbio.com/images2/Recombinant-Mouse-GITR-Ligand-TNFSF18-Protein-Functional-NBP2-26579-img0001.jpg "Functional: Recombinant Mouse GITR Ligand/TNFSF18 Protein [NBP2-26579] - Demonstration of the potency of Fc-mGITRL in comparison to an agonist anti-mGITR antibody (IMG-5920A, clone DTA-1) and anti-CD28 in the presence of anti-CD3. Anti-CD3 antibody serves as a negative control for co-stimulation.")