GIRK2 Antibody - BSA Free

Western Blot: GIRK2 Antibody [NBP2-84043] - Host: Rabbit. Target Name: KCNJ6. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GIRK2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GIRK2. Peptide sequence: AELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GIRK2 Antibody - BSA Free

• BIR1
• BIR1Kir3.2
• G protein-activated inward rectifier potassium channel 2
• GIRK2
• GIRK-2
• GIRK2KATP-2
• hiGIRK2
• Inward rectifier K(+) channel Kir3.2
• inward rectifier potassium channel KIR3.2
• KATP2
• KATP-2
• KATP2human G protein coupled inward rectifier potassium channel 2 (hiGIRK2)10KCNJ7KIR3.2
• KCNJ6
• KCNJ7
• MGC126596
• Potassium channel, inwardly rectifying subfamily J member 6
• potassium inwardly-rectifying channel, subfamily J, member 6

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and may be involved in the regulation of insulin secretion by glucose. It associates with two other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNJ6