GINS4 Antibody

Images

 
Western Blot: GINS4 Antibody [NBP1-82748] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: GINS4 Antibody [NBP1-82748] - Staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GINS4 Antibody [NBP1-82748] - Staining of human kidney shows moderate cytopolasmic positivity in tubular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GINS4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GINS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GINS4 Protein (NBP1-82748PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GINS4 Antibody

  • DNA replication complex GINS protein SLD5
  • GINS complex subunit 4 (Sld5 homolog)
  • GINS complex subunit 4
  • SLD5 homolog
  • SLD5MGC14799

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-92300
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009837-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-33825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-87021
Species: Hu
Applications: WB, IP, PLA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP

Publications for GINS4 Antibody (NBP1-82748) (0)

There are no publications for GINS4 Antibody (NBP1-82748).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GINS4 Antibody (NBP1-82748) (0)

There are no reviews for GINS4 Antibody (NBP1-82748). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GINS4 Antibody (NBP1-82748) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GINS4 Products

Bioinformatics Tool for GINS4 Antibody (NBP1-82748)

Discover related pathways, diseases and genes to GINS4 Antibody (NBP1-82748). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GINS4 Antibody (NBP1-82748)

Discover more about diseases related to GINS4 Antibody (NBP1-82748).
 

Pathways for GINS4 Antibody (NBP1-82748)

View related products by pathway.

Blogs on GINS4

There are no specific blogs for GINS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GINS4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GINS4