GFOD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GFOD1 Antibody [NBP1-89239] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: GFOD1 Antibody [NBP1-89239] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GFOD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GFOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GFOD1 Protein (NBP1-89239PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GFOD1 Antibody

  • ADG-90
  • chromosome 6 open reading frame 114
  • FLJ20330
  • hypothetical protein LOC85411
  • Protein ADG-90
  • RP11-501I19.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NB100-74555
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-90320
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45995
Species: Hu
Applications: WB, IHC
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS12
Species: Hu, Po, Bt, Bv, Ca, Eq, Mk, Pm, Rb
Applications: IHC-P
NB100-78585
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89239
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GFOD1 Antibody (NBP1-89239) (0)

There are no publications for GFOD1 Antibody (NBP1-89239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFOD1 Antibody (NBP1-89239) (0)

There are no reviews for GFOD1 Antibody (NBP1-89239). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GFOD1 Antibody (NBP1-89239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFOD1 Products

Bioinformatics Tool for GFOD1 Antibody (NBP1-89239)

Discover related pathways, diseases and genes to GFOD1 Antibody (NBP1-89239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFOD1 Antibody (NBP1-89239)

Discover more about diseases related to GFOD1 Antibody (NBP1-89239).

Research Areas for GFOD1 Antibody (NBP1-89239)

Find related products by research area.

Blogs on GFOD1

There are no specific blogs for GFOD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFOD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GFOD1