GFI-1 Antibody (3G8)

Product Discontinued

GFI-1 Antibody (3G8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GFI1 (NP_005254, 1 a.a. - 91 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
• Specificity: GFI1 - growth factor independent 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GFI1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against recombinant protein and transfected lysate for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GFI-1 Antibody (3G8)

• GFI1
• GFI-1
• growth factor independence-1
• growth factor independent 1 transcription repressor
• growth factor independent 1
• Growth factor independent protein 1
• Pal-1
• SCN2
• Zinc finger protein 163
• zinc finger protein Gfi-1
• ZNF163
• ZNF163FLJ94509

Background

This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GFI1
• Entrez:
  • 2672(Human)
• OMIM:
  • 202(Human)
• Uniprot:
  • NP_005254(Human)