Gemin 7 Antibody (4H6) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: Gemin 7 Antibody (4H6) [H00079760-M09] - Analysis of monoclonal antibody to GEMIN7 on HeLa cell. Antibody concentration 40 ug/ml

Immunoprecipitation: Gemin 7 Antibody (4H6) [H00079760-M09] - Analysis of GEMIN7 transfected lysate using anti-GEMIN7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GEMIN7 rabbit polyclonal antibody.

ELISA: Gemin 7 Antibody (4H6) [H00079760-M09] - Detection limit for recombinant GST tagged GEMIN7 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IP
• Clone: 4H6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Gemin 7 Antibody (4H6) - Azide and BSA Free Summary

• Immunogen: GEMIN7 (NP_078983.1, 43 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
• Specificity: GEMIN7 - gem (nuclear organelle) associated protein 7 (4H6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GEMIN7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gemin 7 Antibody (4H6) - Azide and BSA Free

• FLJ13956
• gem (nuclear organelle) associated protein 7
• gem-associated protein 7
• gemin 7
• gemin-7
• SIP3

Background

The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GEMIN7
• Entrez:
  • 79760(Human)
• Uniprot:
  • NP_078983(Human)