![Western Blot: GEM Interacting Protein Antibody [NBP3-03540] - Analysis of extracts of various cell lines, using GEM Interacting Protein antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/GEM-Interacting-Protein-Antibody-Western-Blot-NBP3-03540-img0001.jpg "Western Blot: GEM Interacting Protein Antibody [NBP3-03540] - Analysis of extracts of various cell lines, using GEM Interacting Protein antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit GEM Interacting Protein Antibody - Azide and BSA Free (NBP3-03540) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GEM Interacting Protein (NP_057657.2). MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GMIP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GEM Interacting Protein Antibody (NBP3-03540)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GMIP |
![Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP3-03540] - Immunohistochemistry of paraffin-embedded Human liver cancer using GEM Interacting Protein Rabbit pAb (NBP3-03540) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/GEM-Interacting-Protein-Antibody-Immunohistochemistry-Paraffin-NBP3-03540-img0004.jpg "Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP3-03540] - Immunohistochemistry of paraffin-embedded Human liver cancer using GEM Interacting Protein Rabbit pAb (NBP3-03540) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP3-03540] - Immunohistochemistry of paraffin-embedded Mouse spleen using GEM Interacting Protein Rabbit pAb (NBP3-03540) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/GEM-Interacting-Protein-Antibody-Immunohistochemistry-Paraffin-NBP3-03540-img0002.jpg "Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP3-03540] - Immunohistochemistry of paraffin-embedded Mouse spleen using GEM Interacting Protein Rabbit pAb (NBP3-03540) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP3-03540] - Immunohistochemistry of paraffin-embedded Rat spleen using GEM Interacting Protein Rabbit pAb (NBP3-03540) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/GEM-Interacting-Protein-Antibody-Immunohistochemistry-Paraffin-NBP3-03540-img0003.jpg "Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP3-03540] - Immunohistochemistry of paraffin-embedded Rat spleen using GEM Interacting Protein Rabbit pAb (NBP3-03540) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")