GRAF Antibody

Images

 
Western Blot: GRAF Antibody [NBP2-38235] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. ...read more
Immunocytochemistry/ Immunofluorescence: GRAF Antibody [NBP2-38235] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP2-38235] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP2-38235] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP2-38235] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP2-38235] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP2-38235] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRAF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP26
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRAF Protein (NBP2-38235PEP)
Publications
Read Publication using
NBP2-38235 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRAF Antibody

  • FLJ42530
  • GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK)
  • KIAA0621rho GTPase-activating protein 26
  • Oligophrenin-1-like protein
  • OPHN1L1
  • OPHN1LGTPase regulator associated with focal adhesion kinase
  • Rho GTPase activating protein 26
  • Rho-type GTPase-activating protein 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB
NLS2656
Species: Hu
Applications: ICC, IHC, IHC-P, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NB100-56094
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-88830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88831
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00057522-M03
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-83870
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-36945
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for GRAF Antibody (NBP2-38235)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GRAF Antibody (NBP2-38235) (0)

There are no reviews for GRAF Antibody (NBP2-38235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRAF Antibody (NBP2-38235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRAF Products

Bioinformatics Tool for GRAF Antibody (NBP2-38235)

Discover related pathways, diseases and genes to GRAF Antibody (NBP2-38235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRAF Antibody (NBP2-38235)

Discover more about diseases related to GRAF Antibody (NBP2-38235).
 

Pathways for GRAF Antibody (NBP2-38235)

View related products by pathway.

PTMs for GRAF Antibody (NBP2-38235)

Learn more about PTMs related to GRAF Antibody (NBP2-38235).
 

Research Areas for GRAF Antibody (NBP2-38235)

Find related products by research area.

Blogs on GRAF

There are no specific blogs for GRAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRAF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP26
Uniprot