GEM Interacting Protein Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GEM Interacting Protein Antibody [NBP2-30537] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP2-30537] - Staining in human lymph node and skeletal muscle tissues using anti-GMIP antibody. Corresponding GMIP RNA-seq ...read more
Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP2-30537] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: GEM Interacting Protein Antibody [NBP2-30537] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GEM Interacting Protein Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLALVASKLCEETPITSVPRGSLRGRGPSPAAASPEGSPLRRTPLPKHFEITQETARLLSKLD
Specificity
Specificity of human GEM Interacting Protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GMIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GEM Interacting Protein Antibody

  • ARHGAP46
  • GEM-Interacting Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83870
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP1-89732
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-15452
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
H00029127-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GEM Interacting Protein Antibody (NBP2-30537) (0)

There are no publications for GEM Interacting Protein Antibody (NBP2-30537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEM Interacting Protein Antibody (NBP2-30537) (0)

There are no reviews for GEM Interacting Protein Antibody (NBP2-30537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GEM Interacting Protein Antibody (NBP2-30537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GEM Interacting Protein Products

Bioinformatics Tool for GEM Interacting Protein Antibody (NBP2-30537)

Discover related pathways, diseases and genes to GEM Interacting Protein Antibody (NBP2-30537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEM Interacting Protein Antibody (NBP2-30537)

Discover more about diseases related to GEM Interacting Protein Antibody (NBP2-30537).
 

Pathways for GEM Interacting Protein Antibody (NBP2-30537)

View related products by pathway.

PTMs for GEM Interacting Protein Antibody (NBP2-30537)

Learn more about PTMs related to GEM Interacting Protein Antibody (NBP2-30537).

Blogs on GEM Interacting Protein

There are no specific blogs for GEM Interacting Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GEM Interacting Protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GMIP
Uniprot