GRAF Antibody - BSA Free

GRAF-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89732-img0013.jpg

Analysis in human cerebral cortex and pancreas tissues using Anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human pancreas shows low expression as expected.

Analysis in human cell lines Caco-2 and MCF-7 using Anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRAF Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP26
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID:31690048).
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GRAF Protein (NBP1-89732PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRAF Antibody - BSA Free

• FLJ42530
• GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK)
• KIAA0621rho GTPase-activating protein 26
• Oligophrenin-1-like protein
• OPHN1L1
• OPHN1LGTPase regulator associated with focal adhesion kinase
• Rho GTPase activating protein 26
• Rho-type GTPase-activating protein 26

Background

GTPase regulator associated with the focal adhesion kinase pp125.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRAF Antibody (NBP1-89732)(2)

Publications using NBP1-89732

• Rossatti P, Ziegler L, Schregle R et al. Cdc42 Couples T Cell Receptor Endocytosis to GRAF1-Mediated Tubular Invaginations of the Plasma Membrane Cells. [PMID: 31690048] (ICC/IF, Human)
• Bozoky B, Savchenko A, Csermely P et al. Novel signatures of cancer-associated fibroblasts. Int J Cancer 2013-07-15 [PMID: 23319410]

Bioinformatics

• Gene Symbol: ARHGAP26
• Entrez:
  • 23092(Human)
• Uniprot:
  • Q9UNA1(Human)