GRAF Antibody

Images

 
Western Blot: GRAF Antibody [NBP1-89732] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRAF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP26
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRAF Protein (NBP1-89732PEP)
Publications
Read Publication using NBP1-89732.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%). Reactivity reported in scientific literature (PMID: 23319410)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRAF Antibody

  • FLJ42530
  • GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK)
  • KIAA0621rho GTPase-activating protein 26
  • Oligophrenin-1-like protein
  • OPHN1L1
  • OPHN1LGTPase regulator associated with focal adhesion kinase
  • Rho GTPase activating protein 26
  • Rho-type GTPase-activating protein 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB400-153
Species: Hu
Applications: WB, ICC/IF
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89732
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for GRAF Antibody (NBP1-89732)(1)


Reviews for GRAF Antibody (NBP1-89732) (0)

There are no reviews for GRAF Antibody (NBP1-89732). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRAF Antibody (NBP1-89732) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRAF Products

Bioinformatics Tool for GRAF Antibody (NBP1-89732)

Discover related pathways, diseases and genes to GRAF Antibody (NBP1-89732). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRAF Antibody (NBP1-89732)

Discover more about diseases related to GRAF Antibody (NBP1-89732).
 

Pathways for GRAF Antibody (NBP1-89732)

View related products by pathway.

PTMs for GRAF Antibody (NBP1-89732)

Learn more about PTMs related to GRAF Antibody (NBP1-89732).
 

Research Areas for GRAF Antibody (NBP1-89732)

Find related products by research area.

Blogs on GRAF

There are no specific blogs for GRAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRAF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP26
Entrez
Uniprot