GEM Antibody (4B12)

Images

 
Sandwich ELISA: GEM Antibody (4B12) [H00002669-M01] - Detection limit for recombinant GST tagged GEM is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GEM Antibody (4B12) Summary

Immunogen
GEM (AAH22010, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHD
Specificity
GEM - GTP binding protein overexpressed in skeletal muscle
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GEM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GEM Antibody (4B12)

  • GTP binding protein overexpressed in skeletal muscle
  • GTP-binding mitogen-induced T-cell protein
  • GTP-binding protein GEM
  • GTP-binding protein overexpressed in skeletal muscle
  • kinase-inducible Ras-like protein
  • KIRMGC26294
  • RAS-like protein KIR

Background

The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-50419
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IP, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
MAB1059
Species: Hu
Applications: CyTOF-ready, Flow
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
MAB1844
Species: Hu
Applications: CyTOF-reported, Flow
MAB8887
Species: Hu
Applications: Flow
7268-CT
Species: Hu
Applications: BA
MAB2238
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
3015-KR
Species: Hu
Applications: BA
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP2-27500
Species: Mu
Applications: KO, PEP-ELISA, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00002669-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for GEM Antibody (H00002669-M01) (0)

There are no publications for GEM Antibody (H00002669-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEM Antibody (H00002669-M01) (0)

There are no reviews for GEM Antibody (H00002669-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GEM Antibody (H00002669-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GEM Products

Bioinformatics Tool for GEM Antibody (H00002669-M01)

Discover related pathways, diseases and genes to GEM Antibody (H00002669-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEM Antibody (H00002669-M01)

Discover more about diseases related to GEM Antibody (H00002669-M01).
 

Pathways for GEM Antibody (H00002669-M01)

View related products by pathway.

PTMs for GEM Antibody (H00002669-M01)

Learn more about PTMs related to GEM Antibody (H00002669-M01).
 

Research Areas for GEM Antibody (H00002669-M01)

Find related products by research area.

Blogs on GEM

There are no specific blogs for GEM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GEM Antibody (4B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol GEM
Entrez
OMIM
Uniprot