Recombinant Human GEF-H1 Protein (H00009181-Q01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GEF-H1 Protein Summary

Description
GEF-H1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGEAVASES
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARHGEF2

Applications/Dilutions

Application Notes
Western Blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GEF-H1 Protein

  • GEF
  • GEFH1
  • GEF-H1DKFZp547P1516
  • Guanine nucleotide exchange factor H1
  • KIAA0651DKFZp547L106
  • LFP40FLJ45440
  • Microtubule-regulated Rho-GEF
  • P40
  • Proliferating cell nucleolar antigen p40
  • rho guanine nucleotide exchange factor 2
  • Rho/Rac guanine nucleotide exchange factor (GEF) 2
  • Rho/Rac guanine nucleotide exchange factor 2

Background

ARHGEF2 - rho/rac guanine nucleotide exchange factor (GEF) 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF6260
Species: Hu
Applications: WB
AF7250
Species: Hu
Applications: IHC
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
H00009181-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GEF-H1 Partial Recombinant Protein (H00009181-Q01) (0)

There are no publications for GEF-H1 Partial Recombinant Protein (H00009181-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEF-H1 Partial Recombinant Protein (H00009181-Q01) (0)

There are no reviews for GEF-H1 Partial Recombinant Protein (H00009181-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GEF-H1 Partial Recombinant Protein (H00009181-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GEF-H1 Products

Related Products by Gene

Bioinformatics Tool for GEF-H1 Partial Recombinant Protein (H00009181-Q01)

Discover related pathways, diseases and genes to GEF-H1 Partial Recombinant Protein (H00009181-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEF-H1 Partial Recombinant Protein (H00009181-Q01)

Discover more about diseases related to GEF-H1 Partial Recombinant Protein (H00009181-Q01).
 

Pathways for GEF-H1 Partial Recombinant Protein (H00009181-Q01)

View related products by pathway.

PTMs for GEF-H1 Partial Recombinant Protein (H00009181-Q01)

Learn more about PTMs related to GEF-H1 Partial Recombinant Protein (H00009181-Q01).
 

Research Areas for GEF-H1 Partial Recombinant Protein (H00009181-Q01)

Find related products by research area.

Blogs on GEF-H1

There are no specific blogs for GEF-H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
GEF-H1 Antibody
NBP2-21577
GEF-H1 Antibody
NBP2-21577
GEF-H1 Antibody
NBP2-21577

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GEF-H1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF2