Recombinant Human GEF-H1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human GEF-H1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 860-959 of Human GEF-H1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGEAVASES

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARHGEF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GEF-H1 GST (N-Term) Protein

  • GEF
  • GEFH1
  • GEF-H1DKFZp547P1516
  • Guanine nucleotide exchange factor H1
  • KIAA0651DKFZp547L106
  • LFP40FLJ45440
  • Microtubule-regulated Rho-GEF
  • P40
  • Proliferating cell nucleolar antigen p40
  • rho guanine nucleotide exchange factor 2
  • Rho/Rac guanine nucleotide exchange factor (GEF) 2
  • Rho/Rac guanine nucleotide exchange factor 2

Background

ARHGEF2 - rho/rac guanine nucleotide exchange factor (GEF) 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for GEF-H1 Partial Recombinant Protein (H00009181-Q01) (0)

There are no publications for GEF-H1 Partial Recombinant Protein (H00009181-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEF-H1 Partial Recombinant Protein (H00009181-Q01) (0)

There are no reviews for GEF-H1 Partial Recombinant Protein (H00009181-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GEF-H1 Partial Recombinant Protein (H00009181-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GEF-H1 Products

Research Areas for GEF-H1 Partial Recombinant Protein (H00009181-Q01)

Find related products by research area.

Blogs on GEF-H1

There are no specific blogs for GEF-H1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GEF-H1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF2