GDPGP1 Antibody

Images

 
Immunohistochemistry-Paraffin: GDPGP1 Antibody [NBP2-14379] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDPGP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: IAHNLFVTRGAPPGKTSPSSALTGVRVILWARKSSFGIKDGEAFNVALCELAGHLPVKTSQDFSSLTEAAAVALIQDCRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDPGP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot - Reported in scientific literature (PMID:31968056)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GDPGP1 Recombinant Protein Antigen (NBP2-14379PEP)
Publications
Read Publication using NBP2-14379.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDPGP1 Antibody

  • C15orf58
  • chromosome 15 open reading frame 58
  • GDP-D-glucose phosphorylase 1
  • GDP-D-glucose phosphorylase C15orf58
  • VTC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

664-LI
Species: Hu
Applications: BA
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-32767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04922
Species: Hu
Applications: ICC/IF, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-46159
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-84463
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-31333
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-93521
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF7550
Species: Hu
Applications: KO, WB
H00002592-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB110-61576
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB110-57150
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for GDPGP1 Antibody (NBP2-14379)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for GDPGP1 Antibody (NBP2-14379) (0)

There are no reviews for GDPGP1 Antibody (NBP2-14379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDPGP1 Antibody (NBP2-14379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDPGP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDPGP1