GDF-7/BMP-12 Antibody (4F10) Summary
Immunogen |
GDF7 (NP_878248, 361 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
Specificity |
GDF7 - growth differentiation factor 7 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GDF7 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against recombinant protein on ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GDF-7/BMP-12 Antibody (4F10)
Background
This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: BA
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Publications for GDF-7/BMP-12 Antibody (H00151449-M02) (0)
There are no publications for GDF-7/BMP-12 Antibody (H00151449-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GDF-7/BMP-12 Antibody (H00151449-M02) (0)
There are no reviews for GDF-7/BMP-12 Antibody (H00151449-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GDF-7/BMP-12 Antibody (H00151449-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GDF-7/BMP-12 Products
Bioinformatics Tool for GDF-7/BMP-12 Antibody (H00151449-M02)
Discover related pathways, diseases and genes to GDF-7/BMP-12 Antibody (H00151449-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GDF-7/BMP-12 Antibody (H00151449-M02)
Discover more about diseases related to GDF-7/BMP-12 Antibody (H00151449-M02).
| | Pathways for GDF-7/BMP-12 Antibody (H00151449-M02)
View related products by pathway.
|
PTMs for GDF-7/BMP-12 Antibody (H00151449-M02)
Learn more about PTMs related to GDF-7/BMP-12 Antibody (H00151449-M02).
| | Research Areas for GDF-7/BMP-12 Antibody (H00151449-M02)
Find related products by research area.
|
Blogs on GDF-7/BMP-12