We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GDF-15 Recombinant Protein Antigen

Images

 
There are currently no images for GDF-15 Recombinant Protein Antigen (NBP2-68911PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GDF-15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GDF-15.

Source: E. coli

Amino Acid Sequence: EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GDF15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68911.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GDF-15 Recombinant Protein Antigen

  • GDF15
  • GDF-15
  • growth differentiation factor 15
  • growth/differentiation factor 15
  • Macrophage inhibitory cytokine 1
  • MIC-1
  • MIC-1NSAID-activated gene 1 protein
  • MIC1Prostate differentiation factor
  • NAG-1
  • NAG-1NSAID-regulated gene 1 protein
  • NSAID (nonsteroidal inflammatory drug)-activated protein 1
  • PDF
  • PDFGDF-15
  • PLAB
  • PLABNRG-1
  • Placental bone morphogenetic protein
  • Placental TGF-beta
  • PTGF-beta
  • PTGFBPTGF-beta

Background

Growth differentiation factor 15 (GDF15) is a transforming growth factor beta superfamily member that acts to regulate inflammatory and apoptotic responses in injured or diseased tissues. GDF15 is most strongly expressed in the liver, placenta and kidney.

GDF15 antibodies are useful for studies on inflamation and immune system research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2818
Species: Hu
Applications: ICC, WB
M6000B
Species: Mu
Applications: ELISA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
DY1707
Species: Hu
Applications: ELISA
MAB1131
Species: Hu
Applications: ICC, IHC, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DHP250
Species: Hu
Applications: ELISA
1129-ER
Species: Hu
Applications: BA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-85816
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P

Publications for GDF-15 Recombinant Protein Antigen (NBP2-68911PEP) (0)

There are no publications for GDF-15 Recombinant Protein Antigen (NBP2-68911PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-15 Recombinant Protein Antigen (NBP2-68911PEP) (0)

There are no reviews for GDF-15 Recombinant Protein Antigen (NBP2-68911PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GDF-15 Recombinant Protein Antigen (NBP2-68911PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GDF-15 Products

Research Areas for GDF-15 Recombinant Protein Antigen (NBP2-68911PEP)

Find related products by research area.

Blogs on GDF-15.

Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GDF-15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF15