GCSH Antibody (3D8-A12)

Images

 
Sandwich ELISA: GCSH Antibody (3D8-A12) [H00002653-M01] - Detection limit for recombinant GST tagged GCSH is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3D8-A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GCSH Antibody (3D8-A12) Summary

Immunogen
GCSH (AAH00790.1, 1 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Specificity
GCSH - glycine cleavage system protein H (aminomethyl carrier)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GCSH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCSH Antibody (3D8-A12)

  • GCE
  • glycine cleavage system H protein, mitochondrial
  • glycine cleavage system protein H (aminomethyl carrier)
  • lipoic acid-containing protein
  • mitochondrial glycine cleavage system H-protein
  • NKH

Background

The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83374
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
366-6C/CF
Species: Hu
Applications: BA
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-15304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF1107
Species: Mu
Applications: IHC, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP2-46516
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47594
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84490
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
H00002653-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for GCSH Antibody (H00002653-M01) (0)

There are no publications for GCSH Antibody (H00002653-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCSH Antibody (H00002653-M01) (0)

There are no reviews for GCSH Antibody (H00002653-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCSH Antibody (H00002653-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCSH Products

Bioinformatics Tool for GCSH Antibody (H00002653-M01)

Discover related pathways, diseases and genes to GCSH Antibody (H00002653-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCSH Antibody (H00002653-M01)

Discover more about diseases related to GCSH Antibody (H00002653-M01).
 

Pathways for GCSH Antibody (H00002653-M01)

View related products by pathway.

PTMs for GCSH Antibody (H00002653-M01)

Learn more about PTMs related to GCSH Antibody (H00002653-M01).
 

Research Areas for GCSH Antibody (H00002653-M01)

Find related products by research area.

Blogs on GCSH

There are no specific blogs for GCSH, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCSH Antibody (3D8-A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol GCSH
Entrez
OMIM
Uniprot