GCNT2 Antibody

Images

 
Western Blot: GCNT2 Antibody [H00002651-D01P] - Analysis of GCNT2 expression in human liver.
Western Blot: GCNT2 Antibody [H00002651-D01P] - Analysis of GCNT2 expression in transfected 293T cell line by GCNT2 polyclonal antibody.Lane 1: GCNT2 transfected lysate(46.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCNT2 Antibody Summary

Immunogen
GCNT2 (NP_663630.2, 1 a.a. - 402 a.a.) full-length human protein. MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCNT2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCNT2 Antibody

  • bA360O19.2
  • bA421M1.1
  • beta-1,6-N-acetylglucosaminyltransferase 2
  • cataract, congenital
  • CCAT
  • EC 2.4.1.150
  • GCNT2C
  • GCNT5
  • glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
  • glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (Ii blood group)
  • glucosaminyl (N-acetyl) transferase 2, I-branching enzyme
  • I beta-1,6-N-acetylglucosaminyltransferase
  • I-branching beta-1,6-acetylglucosaminyltransferase
  • I-branching enzyme
  • IGNTglucosaminyl (N-acetyl) transferase 5
  • Ii blood group
  • II
  • MGC163396
  • N-acetylglucosaminyltransferase
  • N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase
  • N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
  • NACGT1
  • NAGCT1
  • ULG3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7248
Species: Hu
Applications: WB, ICC
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88313
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GCNT2 Antibody (H00002651-D01P) (0)

There are no publications for GCNT2 Antibody (H00002651-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCNT2 Antibody (H00002651-D01P) (0)

There are no reviews for GCNT2 Antibody (H00002651-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCNT2 Antibody (H00002651-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCNT2 Products

Bioinformatics Tool for GCNT2 Antibody (H00002651-D01P)

Discover related pathways, diseases and genes to GCNT2 Antibody (H00002651-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCNT2 Antibody (H00002651-D01P)

Discover more about diseases related to GCNT2 Antibody (H00002651-D01P).
 

Pathways for GCNT2 Antibody (H00002651-D01P)

View related products by pathway.

PTMs for GCNT2 Antibody (H00002651-D01P)

Learn more about PTMs related to GCNT2 Antibody (H00002651-D01P).

Blogs on GCNT2

There are no specific blogs for GCNT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCNT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCNT2
Uniprot