GCHFR Antibody

Images

 
Western Blot: GCHFR Antibody [H00002644-D01P] - Analysis of GCHFR expression in transfected 293T cell line by GCHFR polyclonal antibody.Lane 1: GCHFR transfected lysate(9.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCHFR Antibody Summary

Immunogen
GCHFR (NP_005249.1, 1 a.a. - 84 a.a.) full-length human protein. MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Specificity
GCHFR - GTP cyclohydrolase I feedback regulator,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCHFR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00002644-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCHFR Antibody

  • GCHFR
  • GFRP
  • GFRPP35
  • GTP cyclohydrolase I feedback regulator
  • GTP cyclohydrolase I feedback regulatory proteinGTP cyclohydrolase 1 feedback regulatory protein
  • HsT16933
  • MGC138467
  • MGC138469
  • p35

Background

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF7250
Species: Hu
Applications: IHC
409-ML/CF
Species: Mu
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP1-83193
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00002644-D01P
Species: Hu
Applications: WB

Publications for GCHFR Antibody (H00002644-D01P)(1)


Reviews for GCHFR Antibody (H00002644-D01P) (0)

There are no reviews for GCHFR Antibody (H00002644-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCHFR Antibody (H00002644-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCHFR Products

Bioinformatics Tool for GCHFR Antibody (H00002644-D01P)

Discover related pathways, diseases and genes to GCHFR Antibody (H00002644-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCHFR Antibody (H00002644-D01P)

Discover more about diseases related to GCHFR Antibody (H00002644-D01P).
 

Pathways for GCHFR Antibody (H00002644-D01P)

View related products by pathway.

PTMs for GCHFR Antibody (H00002644-D01P)

Learn more about PTMs related to GCHFR Antibody (H00002644-D01P).

Blogs on GCHFR

There are no specific blogs for GCHFR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCHFR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCHFR
Entrez
Uniprot