GATE-16/GABARAPL2 Recombinant Protein Antigen

Images

 
There are currently no images for GATE-16/GABARAPL2 Protein (NBP1-88883PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GATE-16/GABARAPL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GABARAPL2.

Source: E.coli

Amino Acid Sequence: SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GABARAPL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88883.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GATE-16/GABARAPL2 Recombinant Protein Antigen

  • Apg8p2
  • ATG8
  • ATG8C
  • FLC3A
  • GABARAPL2
  • gamma-aminobutyric acid receptor-associated protein-like 2
  • Ganglioside expression factor 2
  • GATE16
  • GATE-16
  • GEF2
  • GEF-2
  • GEF2GEF-2
  • General Protein Transport Factor P16
  • Golgi-Associated ATPase Enhancer Of 16 KDa
  • MAP1 light chain 3 related protein
  • MAP1 light chain 3-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KO
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24738
Species: Hu
Applications: WB, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-2220
Species: Hu, Mu, Rt, Po, Av, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow

Publications for GATE-16/GABARAPL2 Protein (NBP1-88883PEP) (0)

There are no publications for GATE-16/GABARAPL2 Protein (NBP1-88883PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATE-16/GABARAPL2 Protein (NBP1-88883PEP) (0)

There are no reviews for GATE-16/GABARAPL2 Protein (NBP1-88883PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GATE-16/GABARAPL2 Protein (NBP1-88883PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am currently interested in detecting GABARAPL2 by immunofluorescence. Do you have an antibody that I could try out for immunofluorescence
    • Here is the link using our search bar and filters: http://www.novusbio.com/productsearch/GABARAPL2#fq=common_name%3A%22GABARAPL2%22&fq=applications%3A%22Immunofluorescence%22

Additional Array Products

Bioinformatics Tool for GATE-16/GABARAPL2 Protein (NBP1-88883PEP)

Discover related pathways, diseases and genes to GATE-16/GABARAPL2 Protein (NBP1-88883PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATE-16/GABARAPL2 Protein (NBP1-88883PEP)

Discover more about diseases related to GATE-16/GABARAPL2 Protein (NBP1-88883PEP).
 

Pathways for GATE-16/GABARAPL2 Protein (NBP1-88883PEP)

View related products by pathway.

PTMs for GATE-16/GABARAPL2 Protein (NBP1-88883PEP)

Learn more about PTMs related to GATE-16/GABARAPL2 Protein (NBP1-88883PEP).
 

Research Areas for GATE-16/GABARAPL2 Protein (NBP1-88883PEP)

Find related products by research area.

Blogs on GATE-16/GABARAPL2

There are no specific blogs for GATE-16/GABARAPL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LC3B Antibody
NB100-2220
LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GATE-16/GABARAPL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GABARAPL2