Recombinant Human GATA-2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human GATA-2 Protein [H00002624-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human GATA-2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-480 of Human GATA2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GATA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
76.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GATA-2 GST (N-Term) Protein

  • endothelial transcription factor GATA-2
  • FLJ45948
  • GATA binding protein 2
  • GATA2
  • GATA-2
  • GATA-binding protein 2NFE1B
  • MGC2306

Background

The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells (Tsai et al., 1994 [PubMed 8078582]). GATA1 (MIM 305371) is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells. In chicken erythroid progenitors, forced expression of GATA2 promotes proliferation at the expense of differentiation (Briegel et al., 1993 [PubMed 8504932]). GATA3 (MIM 131320) expression is restricted to T-lymphoid cells and some nonhematopoietic cell types, including embryonic stem cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
AF2046
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-87992
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MEP00B
Species: Mu
Applications: ELISA
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP1-82580
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC, IHC-P
203-IL/CF
Species: Hu
Applications: BA
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB110-78626
Species: Hu, Mu
Applications: ChIP, Flow, IF, IHC, IHC-P, IP, WB

Publications for GATA-2 Recombinant Protein (H00002624-P01) (0)

There are no publications for GATA-2 Recombinant Protein (H00002624-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-2 Recombinant Protein (H00002624-P01) (0)

There are no reviews for GATA-2 Recombinant Protein (H00002624-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATA-2 Recombinant Protein (H00002624-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GATA-2 Products

Bioinformatics Tool for GATA-2 Recombinant Protein (H00002624-P01)

Discover related pathways, diseases and genes to GATA-2 Recombinant Protein (H00002624-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-2 Recombinant Protein (H00002624-P01)

Discover more about diseases related to GATA-2 Recombinant Protein (H00002624-P01).
 

Pathways for GATA-2 Recombinant Protein (H00002624-P01)

View related products by pathway.

PTMs for GATA-2 Recombinant Protein (H00002624-P01)

Learn more about PTMs related to GATA-2 Recombinant Protein (H00002624-P01).
 

Research Areas for GATA-2 Recombinant Protein (H00002624-P01)

Find related products by research area.

Blogs on GATA-2

There are no specific blogs for GATA-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GATA-2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA2