We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GATA-2 Recombinant Protein Antigen

Images

 
There are currently no images for GATA-2 Protein (NBP1-82581PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GATA-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GATA2.

Source: E. coli

Amino Acid Sequence: LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GATA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82581.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GATA-2 Recombinant Protein Antigen

  • endothelial transcription factor GATA-2
  • FLJ45948
  • GATA binding protein 2
  • GATA2
  • GATA-2
  • GATA-binding protein 2NFE1B
  • MGC2306

Background

The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells (Tsai et al., 1994 [PubMed 8078582]). GATA1 (MIM 305371) is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells. In chicken erythroid progenitors, forced expression of GATA2 promotes proliferation at the expense of differentiation (Briegel et al., 1993 [PubMed 8504932]). GATA3 (MIM 131320) expression is restricted to T-lymphoid cells and some nonhematopoietic cell types, including embryonic stem cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
AF2046
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-87991
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-47940
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
MEP00B
Species: Mu
Applications: ELISA
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
314-BP
Species: Hu
Applications: BA, BA
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP1-82580
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
203-IL
Species: Hu
Applications: BA
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2726
Species: Hu
Applications: Flow, ICC, WB

Publications for GATA-2 Protein (NBP1-82581PEP) (0)

There are no publications for GATA-2 Protein (NBP1-82581PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-2 Protein (NBP1-82581PEP) (0)

There are no reviews for GATA-2 Protein (NBP1-82581PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GATA-2 Protein (NBP1-82581PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GATA-2 Products

Research Areas for GATA-2 Protein (NBP1-82581PEP)

Find related products by research area.

Blogs on GATA-2

There are no specific blogs for GATA-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GATA-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA2