Gastrokine 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Gastrokine 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GKN1.
  
  

  Source: E. coli

  Amino Acid Sequence: NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GKN1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14052.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gastrokine 1 Recombinant Protein Antigen

• 18 kDa antrum mucosa protein
• AMP18
• AMP-18
• AMP18BRICHOS domain containing 1
• BRICD1
• CA11
• CA11MGC70354
• FOV
• Foveolin
• Gastrokine 1
• gastrokine-1
• GKN1
• Protein CA11

Background

GKN1, also known as Gastrokine-1, is a 199 amino acid that is approx. 22 kDa, found to be expressed in stomach; has been shown to have mitogenic activity and may be influencing gastric mucosal epithelium. Studies on this protein have shown a relationship with the following diseases and disorders: patent ductus arteriosus, congenital diaphragmatic hernia, respiratory failure, pulmonary hypertension, hernia, gastric cancer, hypertension, gastritis colorectal cancer, and adenocarcinoma. This protein has been linked to positive regulation of cell proliferation, positive regulation of cell division, and digestion pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GKN1